KEGG   Piscirickettsia salmonis: PSLF89_1679Help
Entry
PSLF89_1679       CDS       T03982                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psal  Piscirickettsia salmonis
Pathway
psal00071  Fatty acid degradation
psal00072  Synthesis and degradation of ketone bodies
psal00280  Valine, leucine and isoleucine degradation
psal00310  Lysine degradation
psal00362  Benzoate degradation
psal00380  Tryptophan metabolism
psal00620  Pyruvate metabolism
psal00630  Glyoxylate and dicarboxylate metabolism
psal00640  Propanoate metabolism
psal00650  Butanoate metabolism
psal00900  Terpenoid backbone biosynthesis
psal01100  Metabolic pathways
psal01110  Biosynthesis of secondary metabolites
psal01120  Microbial metabolism in diverse environments
psal01130  Biosynthesis of antibiotics
psal01200  Carbon metabolism
psal01212  Fatty acid metabolism
psal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    PSLF89_1679
   00630 Glyoxylate and dicarboxylate metabolism
    PSLF89_1679
   00640 Propanoate metabolism
    PSLF89_1679
   00650 Butanoate metabolism
    PSLF89_1679
  Lipid metabolism
   00071 Fatty acid degradation
    PSLF89_1679
   00072 Synthesis and degradation of ketone bodies
    PSLF89_1679
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    PSLF89_1679
   00310 Lysine degradation
    PSLF89_1679
   00380 Tryptophan metabolism
    PSLF89_1679
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    PSLF89_1679
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    PSLF89_1679
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PSLF89_1679
Enzymes [BR:psal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     PSLF89_1679
Exosome [BR:psal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PSLF89_1679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AKP73526
Position
1134081..1135406
Genome map
AA seq 441 aa AA seqDB search
MSTDLPGRAVYLVDGMRTPFLRAQVPEPGPFAAADLAVRAGQSLFSKLSLSPKIIQHIVV
GCGGAAADEMNIARIVGLRLGCEQSTPAFTVQRNCASGLQAVDSGAQLIASGRHDLVLVG
GCEAMSHAPLMSHPNIARWLAQLQKAKGHWQRLKLIPSFPFKNLKPESALLKGLSDPVVG
LSMGQTAEIIAKRFHIDRQMMDAWAAQSHLRALAAQKNNIFSEEITPLYDGKGNSYLIDN
GVRTDSTAERLAKLKPVFDRPYGHVTAGNSSQLTDGACLLLLASDKAVKKYQLKPLAKIK
DVAWAGLDPRHMGLGPVHASHQILKRQKIAIEQIDCWEINEAFAAQTLACLAAFNDLEFC
KSELKLRKAYGVIDREKVNVHGGAIAIGHPVGASGARILLHLAQVLKSNNAPAQGIASLC
IGGGQGGAMLIENCQQKEIVE
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagatttgccagggcgagctgtctatcttgttgatggaatgaggacccccttt
ttacgtgcacaagttccagaacctgggccatttgctgccgctgatttggctgtacgagca
ggacaaagtcttttttcgaagctttccctctctccgaaaatcatccaacacattgtcgtt
ggctgtggtggtgctgctgctgatgaaatgaatatcgcacgtattgttggtttacgttta
gggtgtgaacaaagcacgccggcgtttactgtgcagcgtaactgcgcctctgggctacag
gcggttgatagtggtgcacagctgattgccagtgggcgtcatgatcttgtgttggtaggc
gggtgtgaggcgatgagtcacgctcccttgatgagccatcctaatattgcgcgttggtta
gcgcagctacaaaaagcaaaaggacattggcaaagattaaagcttattccctcgtttcca
tttaaaaacttaaagcctgaaagtgccttattgaaaggtttatctgaccctgtggttgga
ctatcgatggggcaaactgctgagattatcgctaaacgctttcatattgatcggcagatg
atggatgcatgggcggcacaaagccacttgcgtgctctggcagcacagaaaaataatata
tttagcgaagaaattacgcctttatatgatggtaaaggcaatagctatttaattgataat
ggtgttagaactgactcaaccgctgagcgcttagctaagctaaagccagtttttgatcgg
ccttatgggcatgtgactgcaggtaatagctcgcagctcacggatggcgcttgtttatta
ttattggccagtgacaaagcggttaaaaaatatcagctaaaaccgttagcgaaaattaaa
gatgtcgcttgggcaggacttgatcctcgacacatgggtctggggcctgttcatgcgagt
catcagattttaaaacgccagaaaatagctatagaacagatagattgttgggaaattaat
gaggcctttgccgcgcagacattggcttgtctggctgcgtttaatgatcttgaattttgc
aaaagcgagttaaagcttaggaaagcttatggtgtgattgaccgagaaaaagtcaatgtt
cacggcggagcgattgcaattgggcatccggtaggcgcttcaggggcaagaattttattg
catttagcacaggtattaaaatctaacaatgcaccagcacaaggcattgctagtttgtgt
atcggtggtgggcagggtggagcgatgttgattgaaaactgccaacaaaaggagatagtt
gagtga

DBGET integrated database retrieval system