KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0645Help
Entry
Psyr_0645         CDS       T00246                                 

Definition
(RefSeq) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00071  Fatty acid degradation
psb00072  Synthesis and degradation of ketone bodies
psb00280  Valine, leucine and isoleucine degradation
psb00310  Lysine degradation
psb00362  Benzoate degradation
psb00380  Tryptophan metabolism
psb00620  Pyruvate metabolism
psb00630  Glyoxylate and dicarboxylate metabolism
psb00640  Propanoate metabolism
psb00650  Butanoate metabolism
psb00900  Terpenoid backbone biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
psb01200  Carbon metabolism
psb01212  Fatty acid metabolism
psb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Psyr_0645
   00630 Glyoxylate and dicarboxylate metabolism
    Psyr_0645
   00640 Propanoate metabolism
    Psyr_0645
   00650 Butanoate metabolism
    Psyr_0645
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psyr_0645
   00072 Synthesis and degradation of ketone bodies
    Psyr_0645
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Psyr_0645
   00310 Lysine degradation
    Psyr_0645
   00380 Tryptophan metabolism
    Psyr_0645
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Psyr_0645
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Psyr_0645
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Psyr_0645
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psb04147]
    Psyr_0645
Enzymes [BR:psb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Psyr_0645
Exosome [BR:psb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Psyr_0645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-GeneID: 3366123
NCBI-ProteinID: YP_233753
UniProt: Q4ZYQ7
Position
732804..734081
Genome map
AA seq 425 aa AA seqDB search
MTHPRRVAIVGGNRIPFARSNGPYAKASNQDMLTAALEGLIERFNLHGLRMGEVVTGAVL
KHSRDFNLTRECVLGSRLSAQTPAYDIQQACGTGLEAALLVANKIALGQIECGIAGGVDT
TSDAPIGVNEGLRKILLQVNRSKTPGDKLKALMQLRPHHLKPELPRNGEPRTRLSMGQHC
ELMAQTWGIERGPQDQLALESHLKMAAAYAEGWQDDLMTPYLGLIRDNNLRPDLTIEKLA
SLKPAFERSAKGTLSAGNSTPLTDGASVVLLASEEWARERGLPVLAYWRDGEAAAVDFVN
GAEGLLMAPVYAVPRLLARNGLTLQDFDYYEIHEAFAAQVLCTLKAWEDADYCKTRLGLD
APLGSIDRSKLNVKGSSLAAGHPFAATGGRIVANLAKLLDAAGSGRGLISICAAGGQGVT
AILER
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatcctcgtcgggtcgccatcgtcggcggtaaccgcattccgttcgcgcgctcc
aatggcccttatgccaaggccagcaatcaggacatgctcacggctgctctggaagggctg
atcgagcgcttcaatctgcatgggctgcgcatgggcgaggtggtgacgggcgcggtgctc
aagcactccagagacttcaacctgacccgcgaatgcgtgctcggctcgcggctctcggca
cagaccccggcttacgacattcagcaagcgtgcggtacggggctggaagcggcgttgctg
gtggccaacaagatcgctctggggcagatcgagtgcggcattgccggtggcgtggacacc
acgtccgatgccccgatcggcgtcaacgaggggctgcgcaagatcctgctgcaggtaaac
cgcagcaagacgcccggtgacaagctcaaggctctgatgcagttgcgtccacaccacctc
aaaccggagctgccgcgtaacggcgagccacgcacgcgcttgtcgatgggccagcattgc
gagctgatggcgcagacctggggcatagagcgcgggccgcaggatcaactggcgctcgag
agccatctgaaaatggccgcggcctacgccgagggctggcaggatgatttgatgacgccg
tatctggggctgatccgtgacaacaacctgcgtccggacctgacgattgaaaagctggcc
agcctcaagcccgcgttcgagcgcagcgccaagggcaccttgtcggcgggcaattcgaca
ccgctgaccgatggcgcatcggtggtgttgctggccagcgaggagtgggctcgcgagcgg
ggcctgccggtgctggcctactggcgcgacggcgaggccgcagcggtggatttcgtcaac
ggtgcagaagggctgctgatggcgccggtctacgccgttccgcgtctgctggcccgcaat
ggcctgacccttcaggacttcgattactacgaaatccatgaagccttcgccgcgcaggtg
ctgtgtaccctcaaggcctgggaagacgccgactactgcaagacccgcctagggctggac
gcgccgctggggtcgattgatcgcagcaaactgaacgtcaagggcagctcactggctgcc
ggccacccgttcgccgcgaccggaggccgcatcgtcgccaatctggccaagctgctggat
gcggcaggcagcggacgtggattgatttccatctgtgccgcaggcggccagggcgtgacg
gcgattctggagcgttag

DBGET integrated database retrieval system