KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0756Help
Entry
Psyr_0756         CDS       T00246                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01130  Biosynthesis of antibiotics
psb01230  Biosynthesis of amino acids
Module
psb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyr_0756 (trpC)
Enzymes [BR:psb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psyr_0756 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 3366243
NCBI-ProteinID: YP_233852
UniProt: Q4ZYF8
Position
860916..861716
Genome map
AA seq 266 aa AA seqDB search
MSDILNKIKHYKLQEIEAAKADLPFSRLEQRALEQSSPRGFYKALKAKEQQGLIGLIAEI
KKASPSKGLIREDFNPPELAKAYETGGAACLSVLTDTPSFQGSPQFLIDARNACALPVLR
KDFMFDTYQVYEARAWGADCILLIMASLSDDLAAELESAAMTLGMDVLVEVHDEHEMERA
LKLSSPLLGVNNRNLHTFEVDLGTSERLASMVPAGKLLVGESGIGNHNDCLRLKKSGITT
FLVGESLMRKEDVVAATRTLLTGSAD
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatattctaaacaaaataaaacattacaaacttcaggaaatagaggcggcgaaa
gctgacttgccattcagccgcctcgaacagcgtgccctcgaacagtccagcccacgcggt
ttttataaagcactgaaagcaaaagagcagcagggtctgatcggcttgattgcagaaata
aaaaaagccagtccatcaaaaggtctgattcgcgaagacttcaaccctcctgaactggcg
aaggcttacgaaaccggtggcgctgcctgtttatccgttctgaccgacacgccaagcttc
cagggctcgccgcagtttctcattgacgcgcgaaacgcttgcgcccttcctgtgttacga
aaagacttcatgtttgatacgtatcaggtgtatgaggcacgtgcctggggcgcggactgc
atattgctgatcatggcttcattgagtgatgacctggctgccgaacttgaaagtgctgcc
atgacgctggggatggacgtccttgtggaagtgcatgacgaacatgaaatggagcgtgcg
ctgaaactgtcttccccgctgctcggcgtcaataatcgcaacctgcataccttcgaagta
gacctcggcacaagcgagcgactggcatccatggtgcccgcaggcaaactgctggtcggc
gaaagtggtatcggcaaccataatgattgcctgcgactcaagaagtccggcatcactacc
tttctggtcggcgaaagcctgatgcgcaaagaagatgttgtggcggcgacaagaacactg
ctgaccggcagtgcggactga

DBGET integrated database retrieval system