KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0781Help
Entry
Psyr_0781         CDS       T00246                                 

Definition
(RefSeq) chemotaxis-specific methylesterase
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb02020  Two-component system
psb02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:psb00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Psyr_0781
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Psyr_0781
Enzymes [BR:psb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Psyr_0781
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     Psyr_0781
Two-component system [BR:psb02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Psyr_0781
Bacterial motility proteins [BR:psb02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Psyr_0781
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg TAL_effector Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 3366268
NCBI-ProteinID: YP_233877
UniProt: Q4ZYD3
Position
complement(887924..889000)
Genome map
AA seq 358 aa AA seqDB search
MPNKKISVLLVDDSAVVRQVLVAILNDTPDIHVMGAASDPIFAMSKLAQEWPDVIVLDVE
MPRMDGITFLKKIMSERPTPVVICSSLTQKGAETSLQALSAGAVEIITKPTTGLKNFLID
SAAELVAAVRAAANSNVRNLGKRTAAPVLNPASKLTADAILPAASGHAMAQTTERIVAIG
TSTGGTQALEAVLTALPRVCPGMVIVQHMPEKFTASFAERLNSLSQIEVREARNNDRILP
GLALIAPGGKHMMVTRSGAYYHVQVIDGPLVNRHRPSVDVLFRSVAKFAGKNATGIIMTG
MGDDGARGLKEMLDAGSATVAQDEASCVVFGMPKEAIKLNAAQRIIPLQEIHQAILHR
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgccaaacaaaaaaatcagcgtactgctggtcgatgattcggctgtagttcgtcaggta
ctggtggccattctcaacgacacccccgatattcatgtgatgggcgcggcgtcagacccg
atatttgccatgagcaagctcgctcaggaatggccggacgtcattgtgctggacgtggag
atgccgcgcatggacggcatcacctttctcaagaagatcatgagcgagcggccgacgccg
gtggtgatctgctcgtcgctgacccagaaaggcgccgaaacctcattgcaggcgctgtct
gccggggcggtggaaatcatcaccaagcccaccaccgggctgaagaacttcctcatcgat
tcggccgccgagctggttgcagcagtacgcgcagcagccaactccaacgtcagaaacctc
ggcaagcgcaccgccgccccagtgctgaacccagccagcaaactgaccgccgatgccatt
ttgccagctgccagcggccatgccatggcgcagaccactgaacgcatcgtcgccatcggc
acctcgacaggcggtacacaggcactcgaagcggtgctgactgccctgccccgcgtctgt
cccggcatggtcatcgtccagcacatgccggagaaattcaccgcatcgttcgccgaacgc
ctgaacagcctgagtcagatcgaggtgcgcgaggccagaaacaacgaccgcatcctgccc
ggcctcgcgctgatcgcccccggcggtaaacacatgatggtcacgcgcagcggcgcctat
tatcacgtccaggtcatcgacggcccgctggtcaaccgccatcgtccttcggtggacgtg
ctgttccgttcggtggccaaattcgccggcaagaacgccaccggcatcatcatgaccggc
atgggcgacgacggcgcacgcgggctcaaggaaatgctcgacgccggcagcgcgacagtg
gctcaggacgaggccagttgcgtggtgttcggcatgcccaaggaagcgatcaaactgaac
gcggcgcagcggatcattccgctgcaggagattcatcaggcgatcctgcaccggtga

DBGET integrated database retrieval system