KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_0902Help
Entry
Psyr_0902         CDS       T00246                                 

Definition
(RefSeq) hypothetical protein
  KO
K18981  uronate dehydrogenase [EC:1.1.1.203]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00053  Ascorbate and aldarate metabolism
psb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Psyr_0902
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.203  uronate dehydrogenase
     Psyr_0902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_4 NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NmrA
Motif
Other DBs
NCBI-GeneID: 3366394
NCBI-ProteinID: YP_233998
UniProt: Q4ZY12
Position
complement(1021066..1021893)
Genome map
AA seq 275 aa AA seqDB search
MASAHTTQTPFNRLLLTGAAGGLGKVLRETLRPYANVLRLSDIAEMAPAVDDREEVQVCD
LANKDAVHQLVEGVDAIVHFGGVSVERPFEEILGANICGVFHIYEAARRHGVKRVIFASS
NHVIGFYKQTETIDAHSPRRPDSYYGLSKSYGEDMASFYFDRYGIETVSIRIGSSFAEPQ
NRRMMSTWLSFGDLTQLIERSLYTPDVGHTVVYGVSDNKTVWWDNRLASKLDYTPKDSSE
VFREKVDAQPLPAADDPAMLYQGGAFVASGPFGDQ
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggctcataccactcaaactcccttcaatcgcctcctgctgaccggcgcggca
ggcggcctgggcaaggtattgcgcgaaacactgcgcccttacgcaaatgtgctgcggctt
tccgacattgccgagatggcacccgctgtcgacgaccgtgaagaagttcaggtctgcgat
ctggccaacaaggatgccgtacaccaactggtcgaaggcgtcgatgcgatcgtgcatttc
ggcggtgtgtcggtcgagcgaccgttcgaagagatcctcggtgccaatatctgcggcgtg
ttccacatctacgaagcggcccgccggcacggcgtgaaacgcgtgatcttcgccagttcc
aaccacgtgatcggtttctacaagcagaccgagaccatcgacgcgcactcccctcgccgt
ccggacagctactacggtctgtccaagtcctacggcgaagacatggccagcttctacttc
gatcgctacggcatcgaaaccgtcagcatccgcatcggctcctcgtttgccgaaccgcaa
aaccgccgaatgatgagcacctggctgagctttggcgacctgacccagttgatcgaacgc
tcgctgtacacgccagacgtgggccacaccgtggtctacggcgtttcggacaacaagacc
gtgtggtgggacaaccgcctggccagcaaactggattacaccccgaaggacagctcggaa
gtgttccgcgagaaggtcgacgcccagccgctgccggcagccgatgacccggcaatgctc
taccagggcggtgcctttgtcgcttcaggaccgttcggcgaccaataa

DBGET integrated database retrieval system