KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1442Help
Entry
Psyr_1442         CDS       T00246                                 

Definition
(RefSeq) hypothetical protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraC_F_IV AAA_22 AAA_10 FtsK_SpoIIIE DUF87 TrwB_AAD_bind AAA_7 AAA_16 AIG1 ATPase_2 Pox_A32 T2SSE
Motif
Other DBs
NCBI-GeneID: 3366941
NCBI-ProteinID: YP_234530
UniProt: Q4ZWI0
Position
complement(1630375..1633383)
Genome map
AA seq 1002 aa AA seqDB search
MTLFQRLKSRASLNSATQTDIAGDPLLSEPSAVELEQPEDDLVGDLKASDQNDVDAALER
YLKRLEDQGIPAPGDWRNPKQKPATVGDVAALYDVKPSFVDLLPWIEYLPAEQAMLLEDG
KSLAAFFELTPIGTEGRDPEWLRKVRDALENALQNSFDELDTSPWVVQFYAKDETSWDDY
LRNLREYIRPQAKGSPFSELYLDLFKHHLDAIAKPGGLFEDTTVSKLPWRGQQRRVRVVV
YRRVVGDAAFRGQTPAMHLDNICQRFTGGLANAGIKSKRMDGYDIRHWLLQWFNPHPDHL
GTTLKDFDRFFQLVNKRTEDAGEDLPLVTGDDFAQGLFYREPKSDSQKGLWYFDGQPHRV
IMLDRLREAPKTGHLTGETRKGGDALHALFDKLPEDTVLAITLVITPQDVLEAHLEKLAR
KSVGDNQASLLTREAVNDARKLIGREHKLYRGSIAFYLKGNDEAQLTARSMQLTNALLGA
GMEPVASDDEVAPLNSYLRWLPGNFDVNQKRAMDWYVQMMLAQHVANLCPVWGRSSGTGH
PGITLFNRGGAPLTFDPFNKLDRQMNAHMFLFGPTGAGKSATLNNLLNQLIAVYAPRLFI
VEAGNSFGLLGDFAKKLGLTVNRIKLAPNSGVSLAPFADAIRLVNTPSQVKTLDADDLES
SDEDMNAKPDEDDDERDVLGEMEIVARLMITGGEEKEEARLTRADRSVIRQCILAAARIC
SDADRTVLTEDVRNALRAAGEDTSIPEGRRNRMLEMAEAMDMFCMGADGEMFNRTGTPWP
EADLTIVDLATYAREGYNAQLSIAYISLINTVNNIAERDQYKGRPLVNVTDEGHIITKNP
LLAPYIMKITKMWRKLGAWFWLATQNMDDFPPSTAPMLNMIEWWICLNMPPDEVEKISRF
RELTPAQKGLMLSARKESGKYTEGVVLSKSMEVLFRAVPPSLYLALAMTEPEEKKQRYDL
MQSMGVDELGAALEVAADLDRKRGIEPLNITFPTPRALENLA
NT seq 3009 nt NT seq  +upstreamnt  +downstreamnt
atgactctttttcaacggctcaaaagccgcgcgtccctcaattcagctacgcagacggat
atagcgggcgaccctctgctgagcgagccttcagcggtcgaacttgaacagcctgaggat
gatctggttggggatttgaaagcttcagatcaaaacgatgtggatgctgcccttgaacgt
tacctgaagcgactggaggatcagggcatacccgcgccaggcgattggagaaacccgaag
cagaagcctgccacagttggcgacgtcgccgcgctgtacgacgtcaagccgagctttgtc
gacctccttccatggattgagtacctgccagctgagcaagcgatgctgcttgaggatggc
aaatccttggcagcattcttcgaactgactccgatcggcactgaaggccgtgatcccgaa
tggcttcgcaaggtgcgtgacgccttggagaacgcgctgcaaaacagttttgacgagctc
gatacctcaccttgggttgtgcagttctacgcgaaggacgaaaccagctgggatgactac
cttcggaacctgcgtgaatacatccgaccacaggctaaaggcagcccgttctcggagctg
tacctggatcttttcaaacatcacctcgacgcaatcgccaaacctggtggtctttttgaa
gacaccacagtttcaaaattgccttggcgtggccagcagcgccgcgtgcgggtggtcgtg
tatcgccgggtagtcggtgatgcagcgttccgtggccaaacccctgccatgcatctggac
aacatttgtcagcgcttcacaggaggtctggccaacgccggcattaaaagcaaacggatg
gacggttacgacatccgacactggctcctgcagtggttcaaccctcatcccgatcacctg
ggaacgacgctcaaagactttgatcgcttctttcaactggtgaacaaacgcacagaggat
gccggcgaggatctcccactggtcactggcgacgacttcgcacagggactcttttatcga
gagccaaaatccgacagtcaaaaaggcttgtggtacttcgatggccagcctcacagagtc
atcatgctggatcggctgcgcgaagccccgaagaccggccacctgactggcgaaacacgt
aaaggcggtgatgccttgcatgccctgttcgacaagttgcctgaggacactgtgttggcc
atcaccctggtcatcacccctcaggacgtgctggaggctcatcttgagaagctggcacgc
aagtcggtgggtgacaaccaagcttcactactgacccgcgaagcggtaaacgatgccagg
aaactgatcggtcgtgagcacaagctgtaccgaggcagcatcgccttttacctcaaggga
aatgacgaagcacagctcaccgcgcgcagcatgcagttgaccaacgcattgctgggtgcc
ggtatggaacccgtagcatctgacgacgaggtggccccactcaacagctacctccgttgg
cttcccgggaacttcgacgtcaatcaaaagcgagccatggactggtacgtgcagatgatg
ctcgcccagcatgttgcaaacctgtgccctgtgtggggtcgctccagtggtaccgggcat
cctggcatcacgctattcaaccgtggtggggctccactgacatttgatccattcaacaag
ctggatcgtcagatgaatgcccacatgtttctgttcggccccacaggggcaggtaagtcc
gccacgttgaataacctgctcaaccagctcattgcggtttacgctccccgcctgttcatc
gtcgaggcgggtaacagtttcggtctactcggggatttcgcgaaaaagcttgggttgaca
gtcaacaggatcaagctggccccgaactcaggcgttagcctggctccgttcgccgacgct
attcgcttggtaaacacaccgagccaggtcaagaccttggacgctgatgacttagagagc
tctgacgaggacatgaatgccaagcccgatgaagacgatgatgaacgggatgtcctcggc
gagatggaaatcgtagcccgtttgatgatcaccggcggtgaggaaaaagaggaagctcgg
ctgacccgggctgaccgcagcgtaatccgacagtgcatccttgcagcggccagaatttgc
tccgacgccgatcgcaccgtcctgacggaagatgtccgtaatgcgttgcgcgcggccggg
gaagacacctccatcccggagggcagacgcaatcggatgcttgaaatggccgaagccatg
gacatgttttgcatgggcgccgacggggagatgttcaaccgtaccggtacgccttggcct
gaggcagatctgaccatcgtcgacttggccacctacgcacgtgagggctacaacgcccag
ttgtcgatcgcttacatctcgctgatcaacaccgtgaacaacatagcggagcgtgatcag
tacaagggccgtcctctggtcaacgtgacagacgaaggccacatcattaccaaaaacccc
ctcctcgccccttacattatgaagatcaccaaaatgtggcgaaagctcggggcctggttc
tggctggcaacacagaacatggatgactttcctccctcaactgcaccaatgctcaacatg
atcgagtggtggatctgcttgaacatgccgcctgacgaagtggagaagatctcccgtttc
cgtgagctcacacctgcacagaagggcttgatgctgtcagcacgcaaagagagcggtaaa
tacaccgaaggcgttgttctttcgaaatcgatggaagtcctgtttcgcgctgttccgccg
agcctgtacctggcattggccatgaccgagcctgaagagaaaaaacaacgttacgacctg
atgcagtccatgggtgtcgacgagttgggagctgcactggaagtagccgcagatctcgac
aggaaacgaggtattgaacccctgaacattacattcccaacaccccgtgcattggagaac
ctggcatga

DBGET integrated database retrieval system