KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1442
Entry
Psyr_1442         CDS       T00246                                 
Name
(GenBank) conserved hypothetical protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
SSDB
Motif
Pfam: TraC_F_IV P-loop_TraG AAA_22 AAA_10 FtsK_SpoIIIE DUF87 TrwB_AAD_bind AAA_7 AAA_16 AIG1 ATPase_2 T2SSE DUF4913
Other DBs
NCBI-ProteinID: AAY36492
UniProt: Q4ZWI0
Position
complement(1630375..1633383)
AA seq 1002 aa
MTLFQRLKSRASLNSATQTDIAGDPLLSEPSAVELEQPEDDLVGDLKASDQNDVDAALER
YLKRLEDQGIPAPGDWRNPKQKPATVGDVAALYDVKPSFVDLLPWIEYLPAEQAMLLEDG
KSLAAFFELTPIGTEGRDPEWLRKVRDALENALQNSFDELDTSPWVVQFYAKDETSWDDY
LRNLREYIRPQAKGSPFSELYLDLFKHHLDAIAKPGGLFEDTTVSKLPWRGQQRRVRVVV
YRRVVGDAAFRGQTPAMHLDNICQRFTGGLANAGIKSKRMDGYDIRHWLLQWFNPHPDHL
GTTLKDFDRFFQLVNKRTEDAGEDLPLVTGDDFAQGLFYREPKSDSQKGLWYFDGQPHRV
IMLDRLREAPKTGHLTGETRKGGDALHALFDKLPEDTVLAITLVITPQDVLEAHLEKLAR
KSVGDNQASLLTREAVNDARKLIGREHKLYRGSIAFYLKGNDEAQLTARSMQLTNALLGA
GMEPVASDDEVAPLNSYLRWLPGNFDVNQKRAMDWYVQMMLAQHVANLCPVWGRSSGTGH
PGITLFNRGGAPLTFDPFNKLDRQMNAHMFLFGPTGAGKSATLNNLLNQLIAVYAPRLFI
VEAGNSFGLLGDFAKKLGLTVNRIKLAPNSGVSLAPFADAIRLVNTPSQVKTLDADDLES
SDEDMNAKPDEDDDERDVLGEMEIVARLMITGGEEKEEARLTRADRSVIRQCILAAARIC
SDADRTVLTEDVRNALRAAGEDTSIPEGRRNRMLEMAEAMDMFCMGADGEMFNRTGTPWP
EADLTIVDLATYAREGYNAQLSIAYISLINTVNNIAERDQYKGRPLVNVTDEGHIITKNP
LLAPYIMKITKMWRKLGAWFWLATQNMDDFPPSTAPMLNMIEWWICLNMPPDEVEKISRF
RELTPAQKGLMLSARKESGKYTEGVVLSKSMEVLFRAVPPSLYLALAMTEPEEKKQRYDL
MQSMGVDELGAALEVAADLDRKRGIEPLNITFPTPRALENLA
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgactctttttcaacggctcaaaagccgcgcgtccctcaattcagctacgcagacggat
atagcgggcgaccctctgctgagcgagccttcagcggtcgaacttgaacagcctgaggat
gatctggttggggatttgaaagcttcagatcaaaacgatgtggatgctgcccttgaacgt
tacctgaagcgactggaggatcagggcatacccgcgccaggcgattggagaaacccgaag
cagaagcctgccacagttggcgacgtcgccgcgctgtacgacgtcaagccgagctttgtc
gacctccttccatggattgagtacctgccagctgagcaagcgatgctgcttgaggatggc
aaatccttggcagcattcttcgaactgactccgatcggcactgaaggccgtgatcccgaa
tggcttcgcaaggtgcgtgacgccttggagaacgcgctgcaaaacagttttgacgagctc
gatacctcaccttgggttgtgcagttctacgcgaaggacgaaaccagctgggatgactac
cttcggaacctgcgtgaatacatccgaccacaggctaaaggcagcccgttctcggagctg
tacctggatcttttcaaacatcacctcgacgcaatcgccaaacctggtggtctttttgaa
gacaccacagtttcaaaattgccttggcgtggccagcagcgccgcgtgcgggtggtcgtg
tatcgccgggtagtcggtgatgcagcgttccgtggccaaacccctgccatgcatctggac
aacatttgtcagcgcttcacaggaggtctggccaacgccggcattaaaagcaaacggatg
gacggttacgacatccgacactggctcctgcagtggttcaaccctcatcccgatcacctg
ggaacgacgctcaaagactttgatcgcttctttcaactggtgaacaaacgcacagaggat
gccggcgaggatctcccactggtcactggcgacgacttcgcacagggactcttttatcga
gagccaaaatccgacagtcaaaaaggcttgtggtacttcgatggccagcctcacagagtc
atcatgctggatcggctgcgcgaagccccgaagaccggccacctgactggcgaaacacgt
aaaggcggtgatgccttgcatgccctgttcgacaagttgcctgaggacactgtgttggcc
atcaccctggtcatcacccctcaggacgtgctggaggctcatcttgagaagctggcacgc
aagtcggtgggtgacaaccaagcttcactactgacccgcgaagcggtaaacgatgccagg
aaactgatcggtcgtgagcacaagctgtaccgaggcagcatcgccttttacctcaaggga
aatgacgaagcacagctcaccgcgcgcagcatgcagttgaccaacgcattgctgggtgcc
ggtatggaacccgtagcatctgacgacgaggtggccccactcaacagctacctccgttgg
cttcccgggaacttcgacgtcaatcaaaagcgagccatggactggtacgtgcagatgatg
ctcgcccagcatgttgcaaacctgtgccctgtgtggggtcgctccagtggtaccgggcat
cctggcatcacgctattcaaccgtggtggggctccactgacatttgatccattcaacaag
ctggatcgtcagatgaatgcccacatgtttctgttcggccccacaggggcaggtaagtcc
gccacgttgaataacctgctcaaccagctcattgcggtttacgctccccgcctgttcatc
gtcgaggcgggtaacagtttcggtctactcggggatttcgcgaaaaagcttgggttgaca
gtcaacaggatcaagctggccccgaactcaggcgttagcctggctccgttcgccgacgct
attcgcttggtaaacacaccgagccaggtcaagaccttggacgctgatgacttagagagc
tctgacgaggacatgaatgccaagcccgatgaagacgatgatgaacgggatgtcctcggc
gagatggaaatcgtagcccgtttgatgatcaccggcggtgaggaaaaagaggaagctcgg
ctgacccgggctgaccgcagcgtaatccgacagtgcatccttgcagcggccagaatttgc
tccgacgccgatcgcaccgtcctgacggaagatgtccgtaatgcgttgcgcgcggccggg
gaagacacctccatcccggagggcagacgcaatcggatgcttgaaatggccgaagccatg
gacatgttttgcatgggcgccgacggggagatgttcaaccgtaccggtacgccttggcct
gaggcagatctgaccatcgtcgacttggccacctacgcacgtgagggctacaacgcccag
ttgtcgatcgcttacatctcgctgatcaacaccgtgaacaacatagcggagcgtgatcag
tacaagggccgtcctctggtcaacgtgacagacgaaggccacatcattaccaaaaacccc
ctcctcgccccttacattatgaagatcaccaaaatgtggcgaaagctcggggcctggttc
tggctggcaacacagaacatggatgactttcctccctcaactgcaccaatgctcaacatg
atcgagtggtggatctgcttgaacatgccgcctgacgaagtggagaagatctcccgtttc
cgtgagctcacacctgcacagaagggcttgatgctgtcagcacgcaaagagagcggtaaa
tacaccgaaggcgttgttctttcgaaatcgatggaagtcctgtttcgcgctgttccgccg
agcctgtacctggcattggccatgaccgagcctgaagagaaaaaacaacgttacgacctg
atgcagtccatgggtgtcgacgagttgggagctgcactggaagtagccgcagatctcgac
aggaaacgaggtattgaacccctgaacattacattcccaacaccccgtgcattggagaac
ctggcatga

DBGET integrated database retrieval system