KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1455
Entry
Psyr_1455         CDS       T00246                                 

Definition
(RefSeq) hypothetical protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-GeneID: 3366954
NCBI-ProteinID: YP_234543
UniProt: Q4ZWG7
Position
complement(1643124..1643630)
AA seq 168 aa
MTRSVILGAALCLPFMICQAAELTVVEDKGGDSALPYYRSLNPEPSSSVSNDLTSQLDPV
AAQGLPVRTTRMTPGTVQGRIINAPGLQPLFLVGDDETSRRWLQERGAVLKQMQAVGLVV
NVATQERLAVVRSWLPDALVSPASGDELSQRLGLNHYPVLITPTAIEQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atgacccgatcagtgatcctcggcgcagcgctctgcctgccatttatgatctgccaagct
gcagagctcaccgtggttgaagacaaaggtggtgactcagcgctgccttactatcgatct
ctcaatcccgagccgtcctcttctgtctcaaatgacctgacctcgcaactggatcctgta
gcagcacagggattgccggtacgcaccactcgaatgactccggggacagttcagggccga
atcatcaacgcgccaggcctgcagcctttgttcctggtcggggacgatgaaacttcacgc
cgatggctacaagaacgcggtgcggtgctgaagcagatgcaggccgtaggactggtggtc
aacgtggccacacaagaacgacttgccgtagtcaggagttggttgcccgacgcgctggtg
tcccccgcatcaggtgacgagctttctcaacgactcggcctgaatcactatccggtgttg
atcaccccaaccgccatcgagcaatag

DBGET integrated database retrieval system