KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1456Help
Entry
Psyr_1456         CDS       T00246                                 

Definition
(RefSeq) hypothetical protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SLT Glucosaminidase
Motif
Other DBs
NCBI-GeneID: 3366955
NCBI-ProteinID: YP_234544
UniProt: Q4ZWG6
Position
complement(1643627..1644184)
Genome map
AA seq 185 aa AA seqDB search
MAASVTWAGLALLCFVLTSHAAELPPPAYQLAARAANIPSEVLYSVALQESGTPLRGQLV
PWPWTLNVAGASYRFATRADACTALIIALAQAGPKRVDVGLGQVNMGWNGQRFKSSNPCD
ALNPYKNLDVAAQMLAELRALGGDWITVAGRYHRPAGGAPAANYRKAFAKHLSRVTGIQM
LVTNP
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgtcagtgacgtgggcaggccttgccctgctgtgcttcgtgttgacaagccat
gcagccgagcttcccccgccggcttatcagttggctgcccgcgcagcgaacattccgtcg
gaagtgctctactcggtggcactgcaggaaagtgggaccccactgcggggccaactggtc
ccgtggccttggacgctgaacgttgccggtgctagttatcgttttgcaacccgtgccgat
gcctgcaccgcacttatcatcgcactcgcgcaggcgggtcccaagcgggtcgacgtcgga
ttaggtcaggtcaacatgggctggaacggccagagatttaaatcaagcaatccgtgcgac
gcgctcaatccctacaagaacctcgatgtagctgcacaaatgctcgccgaactgcgcgcg
cttggcggtgactggatcaccgtagccggacgctatcaccgccctgccggcggcgctcca
gcagccaattaccgcaaggcctttgccaaacatctcagtcgggtaaccggcatccaaatg
ctggtgaccaatccatga

DBGET integrated database retrieval system