KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1773Help
Entry
Psyr_1773         CDS       T00246                                 

Definition
(RefSeq) phosphate transporter
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
KEGG Orthology (KO) [BR:psb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Psyr_1773
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 3367281
NCBI-ProteinID: YP_234859
UniProt: Q4ZVK1
Position
complement(2018928..2020544)
Genome map
AA seq 538 aa AA seqDB search
MATNALSPDALGKASLSASQFGRKPSRMTMILFFTILIAGLLFTGYSLKQDVDDMGTVVT
TWTPFVLLGVALLIALGFEFVNGFHDTANAVATVIYTHSLPPGFAVVWSGFFNFLGVMFS
SGAVAFGIIALLPVELILQTGSSAGFAMIFALLIAAIIWNLGTWWLGLPASSSHTLIGSI
IGVGIANALMHGRDGTSGVDWSQATKIGYSLLLSPLVGFGCAALLLLAMRMFIKNRALYK
APEGNAPPPLWIRAMLIVTCTGVSFAHGSNDGQKGMGLIMLILVGTLPMAYALNRTMPAE
QATQFAAVAEVTQQALIRSVPQPAPGDARKTLSDYLVSKEASPELIPALAVMAGKIGDQV
ASYGSLSKVPAEAVTNVRNDMYLTSESIRLMEKNKVGDFDADTKTKLEAFKGQIDSATRF
IPTWVKIVVAIALGLGTMVGWKRIVVTVGERIGKTHMTYAQGASAEVVAMFTIGAADMYG
LPVSTTHVLSSGVAGSMVANGSGLQMRTLRNLATAWVLTLPAAILLSGSLYWVFSKLF
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggctacaaacgcactgtctccagacgctctcggcaaggcgagcctgtcagcgagtcaa
ttcggtcgcaagcccagccgaatgaccatgatacttttcttcacgatactcatcgcaggc
ttgctgttcaccggctacagcctcaaacaggacgttgacgacatgggcacggtggtcacc
acctggaccccgttcgtgctgttgggcgtagcgttgctgatcgccttgggcttcgagttc
gtcaacggctttcatgacacggccaacgcggtcgccaccgtgatctacacccactccctg
ccgcccggctttgcagtggtctggtcaggcttcttcaattttctcggcgtgatgttttcc
agcggcgcggtggcattcggcatcattgccctgctgccggtggaactgatcctgcaaacc
ggctcatcggcgggcttcgcgatgatcttcgcgctgttgatcgcggcgatcatctggaac
ctcggcacctggtggctgggtctgccggcgtcctcgtcacacacgctgatcggttcgatc
atcggcgttggcatcgccaacgccctgatgcacgggcgggacggcaccagtggcgtggac
tggtcgcaggccaccaagatcggttactcactgctgctctcgcccctggtgggcttcggc
tgtgcggcgttgctgttgctggccatgcgcatgttcatcaagaaccgcgcgctgtacaag
gctccggaaggcaatgcgccgccaccgttgtggattcgcgccatgctgatcgtgacctgc
acgggcgtgtcgttcgcgcatggctccaacgatgggcagaaaggcatgggcctgatcatg
ctgattctggtcggcacactgccgatggcttatgcgctgaaccgcaccatgcccgccgaa
caggctacccagttcgctgccgtggctgaagtaacccagcaggcgctgatccgcagcgtc
cctcaaccggcccccggggatgcgcgcaagacgctgtcggattacctggtcagcaaggaa
gcgagtcctgagctgatccctgcgctggcggtcatggctggcaagatcggcgatcaggtc
gccagttatggctcgctgtctaaggtgcctgccgaagccgtgaccaacgtgcgtaacgac
atgtatctgacctcggaaagcatccgcctgatggagaaaaacaaggtcggcgatttcgac
gcggacaccaagaccaagcttgaggcgttcaaggggcagatcgacagtgctacgcggttc
attccgacctgggtcaagattgtcgtggccatcgccttgggtctgggcacgatggtcggc
tggaagcgtatcgtggtgacggtgggcgagcgcatcggcaagacgcacatgacttacgcc
cagggcgcgtcggcagaggtcgtggcgatgttcacgatcggcgcggcggacatgtatggg
ctgccggtatccactacgcatgtgctgtcgtccggcgtggccggttcgatggtcgccaat
ggctcggggctgcaaatgcgtaccctgcgtaatctggccactgcctgggtgctgaccctg
ccggcggcgatcctcttgtcaggttcgttgtattgggtgttcagcaagctgttctga

DBGET integrated database retrieval system