KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_1977Help
Entry
Psyr_1977         CDS       T00246                                 

Gene name
gltX
Definition
(RefSeq) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00860  Porphyrin and chlorophyll metabolism
psb00970  Aminoacyl-tRNA biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
Module
psb_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Psyr_1977 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Psyr_1977 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psb01007]
    Psyr_1977 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psb03016]
    Psyr_1977 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:psb02048]
    Psyr_1977 (gltX)
Enzymes [BR:psb01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Psyr_1977 (gltX)
Amino acid related enzymes [BR:psb01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Psyr_1977 (gltX)
Transfer RNA biogenesis [BR:psb03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Psyr_1977 (gltX)
 Prokaryotic Type
   Other AARSs
    Psyr_1977 (gltX)
Prokaryotic defense system [BR:psb02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Psyr_1977 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-GeneID: 3367487
NCBI-ProteinID: YP_235058
UniProt: Q4ZV02
Position
2294713..2296194
Genome map
AA seq 493 aa AA seqDB search
MTTVRTRIAPSPTGDPHVGTAYIALFNYCFAKQHGGEFILRIEDTDQLRSTRESEQQIFD
ALRWLGIDWSEGPDVGGPHGPYRQSERGDIYQKYAQQLVDMGHAFPCFCTAEELDQMRAE
QQAKGETPRYDGRALLLSKEEVQRRLDAGEPHVIRMKVPTEGVCVVPDMLRGEVEIPWDR
MDMQVLMKTDGLPTYFLANVVDDHLMGITHVLRGEEWLPSAPKLILLYEYFGWDKPQLCY
MPLLRNPDKSKLSKRKNPTSVTFYERMGFMPEAMLNYLGRMGWSMPDEREKFSLQEMVDN
FDLSRVSLGGPIFDIEKLSWLNGQWLRDLPVEEFASRLKTWALNPDYMMKIAPHVQGRVE
TFSQVAPLAGFFFAGGVTPDVKLFEHKKLSPEQVRQVMQLILWKLESLRQWEKERIMGCI
QAVVEHLELKLRDAMPLMFAAITGQANSVSVTDAMEILGPDLTRFRLRQALDLLGGVSKK
ENKEWEKLLGSIA
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgttcgtacccgcatcgcgccatcgcccacaggcgacccccacgtcggcacg
gcctacatcgcgctgttcaactactgctttgccaaacagcacggcggcgagttcatcctg
cgcattgaagacaccgatcaactgcgctctacccgcgagtccgaacagcagatcttcgac
gcactgcgctggctgggcatcgactggagcgaaggccccgacgtcggtggtcctcacggt
ccctaccgccagagcgagcgcggcgacatctaccagaaatacgcgcagcaactggtcgac
atgggccatgccttcccgtgcttctgcaccgccgaagaactcgaccagatgcgcgccgaa
cagcaggccaagggcgaaaccccgcgctatgacggtcgtgccttgctgctctccaaggaa
gaggttcagcgccgcctggatgccggcgagccacacgtgatccgcatgaaagtgccgacc
gaaggtgtctgcgtagtacctgacatgctgcgtggcgaagtcgaaatcccgtgggaccgc
atggacatgcaggtcctgatgaagaccgacggcctgccgacctacttcctcgccaacgtg
gtcgatgaccacctgatgggcatcacccatgtactgcgcggcgaagaatggctgccttcg
gcgccgaaactgatcctgctgtacgaatacttcggctgggacaagccgcagctgtgctac
atgccgctgctgcgtaaccccgacaagagcaagctgtccaagcgcaagaaccccacctcg
gtgaccttctacgagcgcatgggcttcatgcccgaggcgatgctcaactacctggggcgc
atgggctggtcgatgcctgacgagcgcgagaagttctccctgcaggagatggtcgacaac
ttcgacctgtcgcgtgtttcgttgggcgggccgatcttcgatatcgagaagctttcctgg
ctcaatggccaatggctgcgtgatctgccggtcgaggagttcgcctcgcgtctgaagacc
tgggcgctgaatcctgactacatgatgaagattgcaccgcatgtgcagggcagggtagag
accttcagtcaggtcgcaccgctggccggcttcttcttcgcaggtggcgtcacgcctgat
gtgaagctgttcgagcacaagaagctgtccccggagcaggtgcgtcaggtgatgcaactg
atcctgtggaagctggaatcgctgcgtcagtgggagaaggagcggatcatgggctgcatc
caggccgtggtcgagcatcttgaactcaagctgcgtgatgccatgccactgatgttcgct
gcgatcaccggccaggccaattcggtgtcggtgaccgatgcgatggaaatcctcggtccg
gacctgacccgcttccggctgcgtcaggccctcgatttgctcggtggcgtttccaagaaa
gaaaacaaggaatgggaaaagcttctgggctctatcgcctga

DBGET integrated database retrieval system