KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2012Help
Entry
Psyr_2012         CDS       T00246                                 

Gene name
sucC
Definition
(RefSeq) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00020  Citrate cycle (TCA cycle)
psb00640  Propanoate metabolism
psb00660  C5-Branched dibasic acid metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
psb01200  Carbon metabolism
Module
psb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Psyr_2012 (sucC)
   00640 Propanoate metabolism
    Psyr_2012 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Psyr_2012 (sucC)
Enzymes [BR:psb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Psyr_2012 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp OKR_DC_1_N
Motif
Other DBs
NCBI-GeneID: 3367526
NCBI-ProteinID: YP_235093
UniProt: Q4ZUW7
Position
2335587..2336753
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGYAVDTPEAAAEACDKIGGTEWVVKAQVHAGGRGKAGGV
KLVRSKEDAAAFAQQWLGKRLVTYQTDANGQPVTKILVESCTDIAKELYLGAVVDRSSRR
IVFMASTEGGVDIEKIAHDTPEKILKATIDPLVGAQPFQGRDLAFQLGLEGKQVTQFAKI
FTGLAKLFQDHDLALLEVNPLVIKADGDLHCLDAKINIDANAMYRQPKLKGFHDPSQDDP
REAHAAKFELNYVALEGNIGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVTE
AFKIILSDANVAAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKIPVVVRLEGNNAELGAKV
LAESGLNIIAATSLTDAAQQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttcacgagtatcagggtaagcagctgttcgctgagtacggcctgccagtatcc
aagggttacgcggtagacaccccggaagcagcagcagaagcctgcgacaagatcggcggg
accgagtgggtcgtcaaagcccaggttcacgcaggtggtcgcggtaaagcgggcggcgta
aagctggttcgcagcaaggaagacgctgcagcgttcgctcaacagtggttgggcaagcgc
ctggtgacttaccagactgacgccaacggtcagccagtgaccaagatcctggtcgagtcc
tgcaccgacatcgccaaagagctgtatctgggcgctgtggtcgatcgttccagccgtcgt
atcgtgttcatggcttccaccgaaggtggcgtggacatcgagaagatcgctcacgacact
cctgaaaagattctcaaggccaccatcgatccactggtcggcgctcagccgttccagggt
cgcgatctggcattccagctgggtctggaaggcaagcaggtcactcagttcgccaagatc
ttcaccggtctggccaagctgttccaggaccatgacctggcattgctggaagtgaacccg
ctggtgatcaaggctgacggcgatctgcactgcctggacgccaagatcaacatcgacgcc
aacgccatgtaccgtcagccaaagctgaagggcttccacgatccttcgcaggacgatcct
cgcgaagctcacgcagccaagttcgaactgaactacgttgcgctggaaggcaacatcggc
tgcatggtcaacggtgccggtctggccatgggtaccatggacatcgtcaacctgcatggc
ggcaagcctgcaaacttccttgacgttggcggcggtgccaccaaggaacgcgttaccgaa
gcgttcaagatcatcctgtccgacgccaacgtcgctgcagtactggtcaacatcttcggc
ggcatcgttcgttgcgacatgattgccgaaggcatcatcggtgcagtgaaagaagtcggc
gttaaaatcccggttgttgtgcgccttgaaggcaacaacgctgagctgggcgctaaagta
ctggcagaaagcggtttgaacatcatcgctgctaccagcctgaccgacgctgctcaacaa
gttgtcaaagccgcggagggcaagtaa

DBGET integrated database retrieval system