KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2297Help
Entry
Psyr_2297         CDS       T00246                                 

Definition
(RefSeq) Short-chain dehydrogenase/reductase SDR
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00030  Pentose phosphate pathway
psb01100  Metabolic pathways
psb01120  Microbial metabolism in diverse environments
psb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Psyr_2297
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     Psyr_2297
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Glyco_tran_WecB
Motif
Other DBs
NCBI-GeneID: 3367812
NCBI-ProteinID: YP_235378
UniProt: Q4ZU32
Position
2669287..2670087
Genome map
AA seq 266 aa AA seqDB search
MHISLKQQVAIVTGASSGLGAGAARALAEAGAAVVINYNSKPEPAEKLAEEIRAAGGKAL
AVGADVSKEEDVERLFAKTIEHFGALDILVANSGLQKDASIVDMSLEDWNTVINVNLTGQ
FLCARAALRQFIKQGMRPEVSRAMGKIIHMSSVHQLIPWAGHVNYAASKGGVDLLMRSIA
QEVGELKIRVNSVAPGAIRTPINADARKGDAEKEMLKLIPYGRIGEPEDVANAVLWLASD
ASDYVHGTTLFIDGGMTLYPEFRGNG
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcacatctcactcaagcaacaagttgcaatcgttaccggcgccagttccggtctgggc
gcaggtgccgcacgcgcgctggcagaggccggtgccgccgtggtgatcaactacaactcc
aagcctgaacctgccgagaaactcgccgaagagattcgtgcggccgggggcaaggcgctg
gctgtgggtgccgacgtttcgaaggaagaagacgtcgagcggctgtttgcaaagaccatc
gaacatttcggcgcgctggatattctggtcgccaattccggcttgcaaaaggacgcgtcg
atcgtcgacatgtccctcgaagactggaataccgtcatcaacgtcaatctgaccgggcag
tttctctgcgcccgcgcagcattgcgccagttcatcaagcagggcatgcgccctgaagtg
tcacgggccatgggcaagatcattcacatgagctcggtgcaccagctgattccatgggcc
gggcacgtcaattacgcagcgtccaagggcggcgtcgacctgttgatgcgcagcatcgct
caggaagtcggcgaactgaagattcgcgtcaacagcgttgcaccgggtgccatccgcacg
ccgatcaatgccgatgcacgcaagggcgacgccgagaaggaaatgctcaagctgatccct
tatggtcgtatcggcgagccggaagacgtcgccaatgccgtgctctggctggcttccgat
gcctcggattatgtgcacggcaccaccctgttcatcgacggcggcatgaccctctatccg
gagttccgtggcaatggctga

DBGET integrated database retrieval system