KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2691Help
Entry
Psyr_2691         CDS       T00246                                 

Definition
(RefSeq) bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase
  KO
K10011  UDP-4-amino-4-deoxy-L-arabinose formyltransferase / UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating) [EC:2.1.2.13 1.1.1.305]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00520  Amino sugar and nucleotide sugar metabolism
psb01100  Metabolic pathways
psb01503  Cationic antimicrobial peptide (CAMP) resistance
Module
psb_M00761  Undecaprenylphosphate alpha-L-Ara4N biosynthesis, UDP-GlcA => undecaprenyl phosphate alpha-L-Ara4N
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Psyr_2691
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Psyr_2691
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:psb01005]
    Psyr_2691
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.305  UDP-glucuronic acid dehydrogenase (UDP-4-keto-hexauronic acid decarboxylating)
     Psyr_2691
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.13  UDP-4-amino-4-deoxy-L-arabinose formyltransferase
     Psyr_2691
Lipopolysaccharide biosynthesis proteins [BR:psb01005]
 Unusual sugar
  Psyr_2691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase Formyl_trans_N GDP_Man_Dehyd Formyl_trans_C 3Beta_HSD NAD_binding_10 TrkA_N Sacchrp_dh_NADP RmlD_sub_bind
Motif
Other DBs
NCBI-GeneID: 3368208
NCBI-ProteinID: YP_235768
UniProt: Q4ZSZ2
Position
3267178..3269172
Genome map
AA seq 664 aa AA seqDB search
MSTKAVVFAYHDIGCVGLQALLDAGYEIAAVFTHADDPREKTFFGSVAQLCARHGIAVHA
PEDPNHPLWVERIGKLAPDFIFSFYYRQLLGDSLLACAKKAALNLHGSLLPRYRGRAPAN
WVLVNGESETGVTLHQMVKRADAGPIVAQQRVSISATDTALTLHGKLRDAAADLLCETLP
LLAAQGQLPATPQDESRATYFGRRTPADGLIDWSLPATQLYNLIRAVTQPYPGAFCPVGD
NKLIVWAASVDTSSNGEAPGTVISHEPLRIACGEGSLVITAGQRGDNGLYLSGEQLAREF
GLVAGSQMLDKAKRRSVRRTRVLILGVNGFIGNHLSERLLQDDRYEIYGMDIGSDAIERL
RAKPNFHFIEGDISIHTEWIEYHIKKCDVVLPLVAIATPIEYTRNPLRVFELDFEENLKI
VRYCVKYNKRVIFPSTSEVYGMCQDANFNEDTSNLIVGPINKQRWIYSVSKQLLDRVIWA
YGQKGLQFTLFRPFNWMGPRLDRLDSARIGSSRAITQLILHLVEGTPIRLVDGGAQKRCF
TDVVDGIEALARIIENRDGRCNGQIINIGNPDNEASIRQLGEELLRQFEAHPLRGHFPPF
AGFREVESQSFYGKGYQDVSHRTPSIDNAKKLIGWTPGIELSETIGKTLDFFLREAMAEK
ADQC
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaaagctgtcgttttcgcttatcacgatattggctgtgtcggcctgcaagcg
ttgctggatgcaggctatgagattgcggcggtgttcacccatgccgacgaccccagggaa
aaaacctttttcggctctgtggcgcagctgtgcgcccggcacggcattgcagtgcatgcc
cccgaggacccgaatcacccgctatgggtagagcgcatcggcaaactggcgccggacttc
attttctccttctactatcgccagttactcggcgattcgttgctggcctgcgcgaaaaaa
gctgcactgaacctgcatggctcgctgcttccgcgttatcgcggacgcgcgccggccaac
tgggtgctggtcaacggcgaaagcgaaaccggcgttaccctgcatcagatggtcaaacgc
gccgatgccgggccgatagtcgcccagcagcgggtctcgatcagtgccaccgataccgcc
ttgacgctgcatggcaaattgcgtgacgccgccgctgacctgctctgcgagacactgccc
ttgctcgccgcacaagggcaactgccagcgacaccccaggatgaatcgcgtgcgacgtat
ttcggtcggcgcaccccggccgacggtttgatcgactggtcgctgccagccactcagctc
tataacctgatccgcgcggtaacacagccctaccctggcgcgttttgcccggtcggcgac
aacaagctgatcgtctgggctgccagcgtggacacaagcagcaatggcgaggcgccgggc
acggtcatcagtcacgagccgttgcgtatcgcctgtggcgagggttcgctggtcatcacc
gcagggcaacgcggtgacaacggcttgtacctcagtggtgagcaactggcacgcgaattc
gggctggtagcaggctcgcaaatgctcgataaggcaaagcgccggtcggttcgtcgtacc
cgcgtgttgatcctcggcgtcaacggtttcatcggcaaccacctgtcagagcgtctgttg
caggatgaccgttacgaaatctacggcatggatatcggctcggacgctatcgagcgcttg
cgcgccaagccgaactttcacttcatcgaaggtgacatcagcatccacaccgagtggatc
gaataccacatcaagaagtgcgatgtcgtgctgccgctggtggctatcgccacgccgatt
gaatacacgcgcaatccactgcgggtcttcgagctggatttcgaagagaacctgaagatc
gtccgctactgcgtcaagtacaacaagcgtgtgattttcccgtccacgtccgaagtctat
ggcatgtgccaggacgcaaacttcaacgaggacacctccaacctgatcgttggcccgatc
aacaagcagcgctggatctactcggtgtccaagcaactgctggaccgggtgatctgggcc
tatggccagaaaggcctgcaattcaccctgtttcgcccgttcaactggatgggaccgcgt
ctggaccgcctggattcggcgcgcattggcagttcgcgggccatcacccaactgatcctg
cacctggtcgaaggcacgcccattcgcctggtggacggcggcgcccagaagcgctgtttc
accgatgtcgtcgacggcatcgaagcgctggcgcggatcatcgaaaaccgcgatgggcgc
tgtaacggacagatcatcaacatcggcaaccccgacaacgaagccagcatccgtcaattg
ggtgaagagctgcttcgccagttcgaagcccatccgttgcgcggccatttcccgcctttc
gcgggctttcgtgaagtcgaaagccagtccttctatggcaagggctatcaggatgtcagc
catcgcacgccgagcatcgacaacgccaaaaagctgattggctggacgccgggtatcgag
ctgagcgaaaccatcggcaaaaccctggatttcttcctgcgcgaagccatggctgaaaaa
gcggatcagtgctga

DBGET integrated database retrieval system