KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_2956Help
Entry
Psyr_2956         CDS       T00246                                 

Definition
(RefSeq) zinc-containing alcohol dehydrogenase superfamily protein
  KO
K00121  S-(hydroxymethyl)glutathione dehydrogenase / alcohol dehydrogenase [EC:1.1.1.284 1.1.1.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00010  Glycolysis / Gluconeogenesis
psb00071  Fatty acid degradation
psb00350  Tyrosine metabolism
psb00625  Chloroalkane and chloroalkene degradation
psb00626  Naphthalene degradation
psb00680  Methane metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
psb01200  Carbon metabolism
psb01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:psb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_2956
  09102 Energy metabolism
   00680 Methane metabolism
    Psyr_2956
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Psyr_2956
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    Psyr_2956
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Psyr_2956
   00626 Naphthalene degradation
    Psyr_2956
Enzymes [BR:psb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Psyr_2956
    1.1.1.284  S-(hydroxymethyl)glutathione dehydrogenase
     Psyr_2956
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Met_10 AlaDh_PNT_C TrkA_N MinC_C 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 3368476
NCBI-ProteinID: YP_236028
UniProt: Q4ZS82
Position
3543485..3544594
Genome map
AA seq 369 aa AA seqDB search
MKSRAAVAFEPGKPLQIVEIDVEPPRKGEVLIKITDTGVCHTDAFTLSGDDPEGLFPVVL
GHEGAGIVMEVGEGVTSVKVGDHVIPLYTAECGECLFCKSGKTNLCTAVRATQGKGVMPD
GTSRFSYNGQPLYHYMGCSTFSEYTVVAEVSVAKINPDANPEHVCLLGCGVTTGIGAVHN
TAKVQPGDTVAVFGLGGIGLAAIQGARQAKAGRIIAIDTNPAKFELARSFGATDCVNPKD
HEQPIQQVIIEMTGWGVDHSFECIGNVHVMRAALECAHRGWGQSIVIGVAGAGQEISTRP
FQLVTGRTWKGSAFGGVKGRSQLPKMVEDAMKGEIELAPFVTHTMGLDRINEAFDLMHEG
KSIRTVIKY
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaagtctcgtgctgcagttgcatttgaacctggcaagccgctccagatcgtcgagatc
gacgtcgagccgccacgcaagggcgaagtgctgatcaagatcaccgataccggtgtatgc
catacggatgctttcacactttcgggcgatgatccggaaggcctgttcccggtagtactg
ggccatgaaggcgccggcatcgtcatggaagtaggcgaaggcgtgaccagcgtgaaagtc
ggtgaccacgtcattccgctgtacaccgccgaatgcggcgagtgcctgttctgtaaatcg
ggcaaaaccaacctgtgcaccgctgtgcgcgccactcagggcaaaggcgtgatgccggac
ggcacttcacgcttctcctacaacggccaacccctgtaccactacatgggttgctcgacc
ttcagcgagtacactgttgtcgctgaagtttctgtcgcgaagatcaatccagacgccaac
cccgagcacgtctgcctgctcggctgcggcgtgactaccggcattggcgcggtgcacaac
acggccaaagtccagcctggcgacacagtcgcggtatttggcctgggcggcatcggtctg
gcggcgattcagggtgcgcgtcaggccaaggcaggacgcatcatcgctatcgacaccaac
cctgccaagttcgaactggcccgttcgtttggcgctaccgactgtgtgaatccaaaagat
cacgaacagccgatccagcaggtgatcattgagatgactggctggggtgtcgaccactcc
ttcgaatgtatcggtaacgtgcatgtgatgcgcgctgcgctcgaatgtgcccaccgcggc
tggggccaatcgatcgtcattggtgttgccggtgccggtcaggaaatctcgacccgtccc
ttccagctggtcaccggccgtacctggaaaggctcggcgtttggcggcgtaaaaggccgt
agccaactgccgaagatggttgaagacgcgatgaaaggcgagatcgagctggcacctttt
gtcactcacaccatgggcctggatcgcatcaatgaagcgtttgacttgatgcacgaaggc
aagtcgatccgcaccgtcatcaaatactga

DBGET integrated database retrieval system