KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3075
Entry
Psyr_3075         CDS       T00246                                 

Definition
(GenBank) Type I secretion membrane fusion protein, HlyD
  KO
K11003  hemolysin D
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psyr_3075
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:psb02000]
    Psyr_3075
   02044 Secretion system [BR:psb02044]
    Psyr_3075
Transporters [BR:psb02000]
 Other transporters
  Accessory factors involved in transport [TC:8]
   Psyr_3075
Secretion system [BR:psb02044]
 Type I secretion system
  alpha-Hemolysin/cyclolysin transporter
   Psyr_3075
SSDB
Motif
Pfam: HlyD_3 HlyD_D23 Biotin_lipoyl_2 HlyD Biotin_lipoyl PEHE
Other DBs
NCBI-ProteinID: AAY38109
UniProt: Q4ZRW3
Position
complement(3676622..3678043)
AA seq 473 aa
MSNAESTGLLQRYRRVWRQSWRHRREMDAPKRLAHEVQFLPAALELQDKPSHPAPRVFMW
AIMFFAALALLWACLGKIDVVATASGKIIPSGKTKTIQSSETAVVKAIHVRDGQSVKAGQ
LLLELDSTSADADVGRVRSDLLAARIDSARAAAMLDAINQRKPPRDLTGTILDADPMHVL
AAERWLQGQYQEYRSSLDLVDAEIQQRQADIQAARIQVMSLQKTLPIATKLASDYENLLK
KQYIARHAYLEKEQARLDLERQLSVQQASVLQSTAARQEAERRREGVVAQTRRAMLDLLQ
QADQKIASFNQDLTKARYQEDLTTLEAPVDGTVQQLAVHTVGGVVTPAQPLMVLVPDGQP
VEVEAMLENKDVGFVRAGQAVTVKVETFTFTKYGTIEGEVISVSNDAIEDEKRGLIYSSK
IRLNSDTLNVNGVDIKLSPGMAVTAEVTTNKRRVIEYFLSPLQQHASESFRER
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgtctaacgccgaatcgaccggactactgcagcgctaccgccgcgtgtggcgccaatct
tggcgtcaccgtcgtgagatggatgcccccaagcgcttggcgcatgaagttcagtttctg
cccgctgcgctggaactccaggataaacccagtcatcccgcgccgcgtgttttcatgtgg
gcgatcatgttttttgccgctctggcgttgctatgggcatgcctgggcaagattgacgtg
gtagcgacagccagcggcaaaatcattcccagcggcaagacgaaaaccattcagtccagt
gaaaccgctgtggtcaaggcgattcatgtgcgtgacgggcaatcggtcaaggccggtcag
ttgcttttggagctggactccacatctgcggatgctgatgtcggacgcgtccgcagtgat
ttgctggctgcgcgaatcgacagcgctcgcgcggctgccatgctcgacgcaatcaatcag
cgcaagccacctcgggatctgaccggcaccatactggatgccgacccgatgcatgtattg
gcggctgagcgctggctgcagggccagtatcaagagtaccgcagtagccttgacctggta
gacgccgaaattcagcaacgccaggccgacattcaggccgcgcgtattcaagtcatgagt
ttgcagaaaactttgcctatcgccaccaagctggcaagtgactacgaaaacctcctgaaa
aagcagtacatcgcccgtcacgcttacctggaaaaggaacaagcgcgcctggacctcgaa
cgccaactgagcgtgcagcaagccagcgtcctgcagtccaccgccgcccgccaggaagca
gagcgccgccgcgaaggcgtggtcgcccagacccgccgcgccatgcttgacctgttgcag
caagccgatcaaaagatcgcatctttcaatcaggacctgaccaaggctcgctatcaggaa
gacctcaccaccctcgaagcgccggtagacggcaccgtccagcaactggccgtgcacacc
gtcggcggcgtagtcacccccgcacaaccgctgatggtattagtccccgacggccagccc
gtggaagtggaagccatgctggaaaacaaggacgtcggctttgttcgcgccgggcaggcc
gttaccgtcaaggtcgaaacgttcaccttcaccaagtacggcacgatagaaggcgaagtc
atcagcgtctccaacgacgccatcgaagatgaaaagcgcggcttgatctacagcagcaag
attcgtcttaacagcgatacgctgaatgtgaatggcgtggacatcaagttgtcgccgggc
atggcggtgacggcggaagtgacgacgaacaagcggcgggtgattgagtatttcctgagt
ccgttgcagcagcatgcgtcggagagtttcagggagcggtag

DBGET integrated database retrieval system