KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_3572Help
Entry
Psyr_3572         CDS       T00246                                 

Gene name
acsA
Definition
(RefSeq) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00010  Glycolysis / Gluconeogenesis
psb00620  Pyruvate metabolism
psb00640  Propanoate metabolism
psb00680  Methane metabolism
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01120  Microbial metabolism in diverse environments
psb01130  Biosynthesis of antibiotics
psb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Psyr_3572 (acsA)
   00620 Pyruvate metabolism
    Psyr_3572 (acsA)
   00640 Propanoate metabolism
    Psyr_3572 (acsA)
  Energy metabolism
   00680 Methane metabolism
    Psyr_3572 (acsA)
Enzymes [BR:psb01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Psyr_3572 (acsA)
Lipid biosynthesis proteins [BR:psb01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Psyr_3572 (acsA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N DUF3828
Motif
Other DBs
NCBI-GeneID: 3369103
NCBI-ProteinID: YP_236642
UniProt: Q4ZQG8
Position
complement(4253732..4255687)
Genome map
AA seq 651 aa AA seqDB search
MSAASLYPVRPEVAATTLTDEATYKAMYQQSVVNPDGFWREQAQRLDWIKPFSVVKQTSF
DDHRVDIKWFADGTLNVAYNCLDRHLEERGDSIAIIWEGDDPSEHREITYRELHAEVCKF
ANALRGQDVHRGDVVTIYMPMIPEAVVAMLACARIGAIHSVVFGGFSPEALAGRIIDCSS
KVVITADEGLRGGKKTALKANVDRALTNPETSSVQKVIVCKRTGGEIEWNRHRDIWYHSL
LEVASSTCAPKEMGAEESLFILYTSGSTGKPKGVLHTTAGYLLYAALTHERVFDYRPGEV
YWCTADVGWVTGHSYIVYGPLANGATTLLFEGVPNYPDITRVSKIIDKHKVNILYTAPTA
IRAMMAEGTKSVEGADGSSLRLLGSVGEPINPEAWAWYYNTVGKQNCPIVDTWWQTETGG
ILISPLPGATALKPGSATRPFFGVIPALVDNLGNLIEGAAEGNLVILDSWPGQSRSLYGD
HDRFVDTYFKTFRGMYFTGDGARRDEDGYFWITGRVDDVLNVSGHRMGTAEIESAMVAHP
KVAEAAVVGVPHDLKGQGIYVYVTLNGGEEPSDALRTELRNWVRKEIGPIASPDFIQWAP
GLPKTRSGKIMRRILRKIATAEYDALGDISTLADPGVVQHLIDTHKTMNAA
NT seq 1956 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcagcttccctgtaccccgtccgcccagaagtcgcagcgactacgctgacggat
gaagcgacctacaaggccatgtaccagcagtcggtggtcaaccctgatggtttctggcgt
gaacaggctcagcgcctcgactggatcaaacctttcagtgtggtcaaacagacctcgttc
gatgatcaccgtgtcgatatcaaatggttcgccgacggcacgctgaacgttgcctacaac
tgcctggatcgccatctggaagaacgcggcgacagcatcgccatcatctgggagggcgac
gacccttccgagcaccgggaaatcacctaccgcgaactgcacgccgaagtgtgcaagttc
gccaacgccctgcgtggccaggatgtgcaccgtggcgacgtcgtgacgatctacatgccg
atgatccccgaagctgtggtcgccatgctggcatgcgcccggatcggtgcgattcactcg
gtggtgttcggcggtttctcgcccgaagcgctggctggccggatcatcgattgcagttcc
aaagtggtcatcactgctgacgaaggtctgcgtggcggcaagaagactgcactcaaggcc
aacgtcgaccgcgccctgaccaacccggaaaccagcagcgtgcagaaggttatcgtctgc
aagcgcaccggtggcgagatcgaatggaaccgtcaccgtgatatctggtaccactcgctt
ctggaagtggcgtccagcacctgcgcgccgaaagagatgggcgccgaagagtcgctgttc
attctctacacctcgggctcgaccggtaaacccaagggcgtgttgcacaccaccgcaggt
tacttgctgtatgccgcgctgacccacgaacgcgtgttcgactaccggccgggtgaagtt
tactggtgcaccgccgacgtcggctgggtcaccgggcacagttacattgtctacgggcct
ctggccaacggtgcgaccacgctgctgttcgaaggcgtgccgaactatccggacatcacc
cgcgtgtcgaagatcatcgacaagcacaaggtcaatatcctctacaccgcgccgaccgcg
attcgcgccatgatggctgaaggcaccaagtccgttgaaggtgccgacggttcaagcctg
cgcctgctgggttcggtgggcgagccgatcaacccggaagcctgggcctggtactacaac
acggtcggcaagcagaactgcccgattgtcgatacctggtggcagaccgaaaccggtggc
attctgatcagcccgttgccaggtgcgaccgccctgaagccgggctcggcgacacgtccg
ttcttcggcgtgatcccggcgctggtggacaacctgggcaacctcatcgagggcgctgcc
gagggcaacctggtgatcctcgattcgtggccgggccagtcgcgctctctgtacggcgat
cacgaccgtttcgtcgacacctacttcaagacgttccgcggcatgtacttcaccggtgac
ggcgcccgtcgtgacgaggacggctatttctggatcaccgggcgtgtggacgacgtgctc
aacgtttccggccaccgcatgggcacggctgaaatcgaaagcgcgatggttgcgcacccg
aaagtcgccgaggctgctgtggtcggtgtgccgcatgacctgaaggggcagggcatctac
gtctatgtgaccctcaacggcggtgaagagccgagtgacgcgctgcgcaccgaattgcgc
aactgggtacgcaaggagatcggcccgattgcctcgcctgacttcattcagtgggcgccc
ggcctgccgaagacccgttcgggcaagatcatgcgccgtatcctgcgcaagattgcgact
gccgagtacgatgcgctgggtgacatctccaccctggccgacccgggcgtggtgcagcat
ctgatcgatacgcacaagaccatgaacgctgcctga

DBGET integrated database retrieval system