KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4164Help
Entry
Psyr_4164         CDS       T00246                                 

Gene name
gatC
Definition
(RefSeq) aspartyl/glutamyl-tRNA amidotransferase subunit C
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00970  Aminoacyl-tRNA biosynthesis
psb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psb00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Psyr_4164 (gatC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:psb03029]
    Psyr_4164 (gatC)
Enzymes [BR:psb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Psyr_4164 (gatC)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Psyr_4164 (gatC)
Mitochondrial biogenesis [BR:psb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Psyr_4164 (gatC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 3369701
NCBI-ProteinID: YP_237232
UniProt: Q4ZNS8
Position
4953839..4954126
Genome map
AA seq 95 aa AA seqDB search
MALERSDVEKIAHLARLGLNDADIPRTTEALNSILGLVDQMQAVDTTGIEPLAHPLEATQ
RLREDAVTERNRRDTYQAIAPAVQDGLYLVPKVIE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttgaacgctccgacgtggaaaagatcgctcatctggcccgactgggcctcaat
gacgccgatatcccgcgtaccaccgaagcacttaacagtattcttgggctggtcgatcag
atgcaagcggtcgacaccactggcatcgagccgctggctcacccgctggaagccacccag
cgcctgcgcgaagacgccgtcaccgagcgaaatcgtcgtgacacttaccaagccatcgca
ccagcggtccaagacgggctgtatctggttccgaaagtcatcgagtaa

DBGET integrated database retrieval system