KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4579Help
Entry
Psyr_4579         CDS       T00246                                 

Gene name
trpC
Definition
(RefSeq) indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psb01100  Metabolic pathways
psb01110  Biosynthesis of secondary metabolites
psb01130  Biosynthesis of antibiotics
psb01230  Biosynthesis of amino acids
Module
psb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:psb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Psyr_4579 (trpC)
Enzymes [BR:psb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Psyr_4579 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-GeneID: 3370128
NCBI-ProteinID: YP_237647
UniProt: Q4ZML3
Position
complement(5441145..5441981)
Genome map
AA seq 278 aa AA seqDB search
MSVPTVLEKILARKAEEVAARRAIVGLTELEQQAARADAPRGFAKALITQAKAKQPAVIA
EIKKASPSKGVIREHFLPGEIARSYQAGGATCLSVLTDVDFFQGADAYLQEARAACNLPV
IRKDFMIDPYQVVEARALGADCILLIVSALDDVQMAELAAVAKGLKLDVLVEVHDGDELE
RALKTLDTPLVGINNRNLHTFEVSLETTLDLLPRIPRDRLVVTESGILNRADVELMEISD
VYSFLVGEAFMRAEHPGAELQRLFFPERKIAVSASSSD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgagtgtgccaaccgtactggaaaagatccttgcccgaaaggccgaggaagttgcggct
cgtcgtgcgattgttggcctgaccgagcttgaacaacaggcagcccgggccgacgcgcca
cgtggctttgccaaggcattgatcactcaggccaaggcaaagcagcctgccgttatcgcg
gaaatcaagaaggcctcgccgagcaagggcgtcatccgcgaacacttcctgccgggcgag
atcgccagaagttatcaggccggtggcgcgacctgtctgtcagtgctgaccgatgtggac
ttctttcagggcgccgatgcctatctgcaggaggcacgtgcggcgtgcaacctgccagtg
atccgcaaggatttcatgatcgacccttatcaggtggtcgaagcacgtgctttgggcgct
gactgcattctgttgatcgtgtcggcactggatgacgtgcaaatggctgaactggctgcc
gttgccaagggcctgaagctggatgtactggtcgaggtgcacgacggcgacgaactggag
cgcgcactcaaaacgctcgatacaccgctggtgggtatcaacaaccgcaaccttcatacc
tttgaggtgagcctggaaactaccctggacttgctgccgcgcatcccgcgtgatcgcctg
gtcgttaccgaaagcggcattctcaatcgtgcggatgtcgagctgatggaaatcagcgat
gtctattcgtttctggtgggtgaggccttcatgcgtgccgaacacccgggcgccgagttg
cagcggttgttcttcccggagcgcaagattgcagtaagcgcttcgtccagcgactga

DBGET integrated database retrieval system