KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4628Help
Entry
Psyr_4628         CDS       T00246                                 

Gene name
apaG
Definition
(RefSeq) ApaG protein
  KO
K06195  ApaG protein
Organism
psb  Pseudomonas syringae pv. syringae B728a
Brite
KEGG Orthology (KO) [BR:psb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Psyr_4628 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-GeneID: 3370177
NCBI-ProteinID: YP_237696
UniProt: Q4ZMG4
Position
5488538..5488939
Genome map
AA seq 133 aa AA seqDB search
MDFKAYCMPDSRYKVDVSVVTRFLSEQSQPEQNRFAFAYTITVHNNGELPARLLSRHWVI
TDGDGNVEEVRGEGVVGQQPLIKNGHSHTYSSGTVMTTKVGNMQGTYQMLAEDGKRFDAV
IEPFRLAVPGSLH
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atggatttcaaggcctattgcatgcccgattctcgttacaaggtcgacgtcagcgtcgtc
acacgcttcctctcggaacaatcacaacccgagcagaaccgcttcgctttcgcctacacc
atcaccgtgcacaacaacggcgagttacctgcccgactgctgtcgcggcactgggtcatc
accgacggtgatggcaatgtcgaggaagtgcgtggcgaaggcgtggttggccagcagcca
ctgatcaagaacggccacagccatacctacagcagtggtacggtcatgaccaccaaggtc
ggcaacatgcagggcacctatcagatgctggccgaagacggcaaacgcttcgatgccgtc
atcgagccattccggctggccgttccgggctcgctgcactga

DBGET integrated database retrieval system