KEGG   Pseudomonas syringae pv. syringae B728a: Psyr_4983Help
Entry
Psyr_4983         CDS       T00246                                 

Definition
(RefSeq) Rhs element Vgr protein
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
psb  Pseudomonas syringae pv. syringae B728a
Pathway
psb03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psb00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Psyr_4983
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psb02044]
    Psyr_4983
Secretion system [BR:psb02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Psyr_4983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phage_GPD Phage_base_V DUF2345 Gp5_C
Motif
Other DBs
NCBI-GeneID: 3370535
NCBI-ProteinID: YP_238048
UniProt: Q4ZLG2
Position
5908301..5910145
Genome map
AA seq 614 aa AA seqDB search
MDLSSLFTAQNRRLFKLTMALKGGQELLLDSFAGSEGLSADFGFQLDLISDDASVKLKSA
IGQSATIEIELATGGSRYINGHVLSFGNNGSDGGMSRYSAYIGSWLSLIAQRYDSQIYQD
QTVEQVIRKVLGRYDGLAKYEFRVNRTLKPYSYITQYRESDSHFVMRLLEQEGLFFYFEH
TADSHTLIIMDDSTVLTPLPEQPQVRFHTASVTETSDSITHWSSAREFQAGKISVQTFDY
RQPGNRIPVTMNSLNQQGDVPSYEIFDYMGQYTHGTPEDGELLVRNRIEALELKGKTFVG
SSNCRAMRPGYTFELTQHYEHDTGSPDDRQFLLMNIEHRGSNNYTSGSQAGYANKIYCVR
KKIKFRPQMDLLKPGISGPQTAIVVGPPGEEIYTDEMGRVKVQFHWDRYGKFDDKSSCWV
RVAQSGASGGFGSMQIPRVGDEVVVVFLDGNPDRPLVMGSLYNSQNTPPWSLPANKTQSG
FLTRSAKGDGGTANFFRFEDKAGAEQVIMHAERNMDTEIELDEKHEVGNNRKVTVGGTNT
EIIQKDTVTNVQQGSFTLKVDNQFIQVDAKQYILLKVGDSSISITPEGIQIKGKVINVLG
ESTFVKGDRVDINK
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggatctatcctcactgtttacggcgcagaacagacgactgttcaagctgacgatggcc
ctcaagggtggccaggagctgttgcttgattcctttgccggtagtgaaggtttatcggct
gatttcgggtttcaactcgatctgatttctgatgatgcgagcgtaaagcttaagtccgct
atagggcagtccgcgaccatcgaaatcgaactcgccaccggaggcagccgttacattaac
ggtcatgtattgagcttcggtaacaatggcagcgacggtggcatgtcgcgctattcagcc
tacataggctcgtggttgagcctgattgcgcagaggtacgattctcagatctatcaggat
cagacagtggagcaggtgatccggaaggtattgggtcgctacgatgggcttgcgaagtac
gagttccgtgtcaatcgcacgctcaagccatacagctacatcacccaataccgcgaaagc
gatagtcacttcgtcatgcgcctgctggagcaggagggtttgttcttctactttgagcat
acggcggacagccatacgctgatcatcatggacgactcgactgtactcacaccgcttcca
gagcagccccaggttcgcttccatacagcttctgtaaccgaaacctctgactccatcacc
cactggagttcagcccgggaattccaggctggcaagatttcggtacaaaccttcgattac
aggcagccaggaaatcgtattcccgtcacgatgaacagccttaatcagcaaggcgatgtt
ccatcgtatgaaatctttgattacatggggcagtacacgcacggcacgcccgaagatggt
gagctcctcgtgcgtaatcgtatcgaggcactggagctaaaaggtaagacattcgtaggg
tcgagtaactgtcgggcgatgcgtccaggttacacatttgaactgacgcaacattacgag
catgacacgggctctcccgatgatcggcagttcctgttaatgaatatcgagcatcgcggc
agcaataattacacctcgggcagtcaggcgggttacgccaataaaatttattgcgtacgc
aaaaaaatcaagttccggcctcagatggatttgctcaagccaggcatctccggcccccaa
accgccatcgtcgtcggcccgcccggcgaagaaatctacaccgacgaaatgggccgggta
aaagtgcagttccactgggaccgctacggcaagtttgacgacaaaagctcctgctgggtc
cgcgtcgctcaatccggcgcaagtggcggttttggtagcatgcagatcccgcgcgtcggt
gacgaggtggtggtcgttttcctggatggcaaccctgaccgtccactcgtcatgggcagt
ttgtataacagccagaacacgccgccgtggtcgctgcctgccaacaagacccagagtggt
ttcctgacgcgttcggccaagggggatggcggtacggccaacttcttccgctttgaagat
aaggccggtgccgaacaggtgatcatgcatgccgagcgcaacatggacacagagatcgag
ctggatgaaaagcacgaggtgggcaataaccgcaaggtgacggtcggcggcacgaatacg
gaaatcatccagaaagatactgtgacgaacgtgcagcaggggtcgtttacgctaaaggtc
gacaaccaattcattcaggtggatgccaagcagtacatccttctcaaagtgggcgacagc
agcatctcgatcactccggaaggcattcagataaaaggcaaagtgatcaatgttcttggc
gagagcaccttcgtcaaaggtgaccgagtcgacatcaacaagtga

DBGET integrated database retrieval system