KEGG   Pseudomonas stutzeri CCUG 29243: A458_00670
Entry
A458_00670        CDS       T02168                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
psc  Pseudomonas stutzeri CCUG 29243
Brite
KEGG Orthology (KO) [BR:psc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psc02044]
    A458_00670
Secretion system [BR:psc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A458_00670
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: AFM31402
UniProt: I4CMU5
Position
complement(134835..136625)
AA seq 596 aa
MSFNHYYQSELTALRQLGKRFAERSPALAPFLGQAGRDPDVERLLEGFAFLTGRLRQKLD
DELPELTHSLMHLLWPNYMRPLPAFSMLQFDPLKRPGPALTVPRNTPVESNPVQGVSCCF
RTAYATEVLPLALQALEYSVKGTGALLSLRLQMSADGHLGEIGLNHLRLHLAGEPYISQL
LYLSLLRHLGGIELVPLDAQGHPLTGPDGRPLTPLQLNAKQVEPVGFAEDEALIPYPLNT
FRGYRYLQEYFAFPDKFLFVDLKGLEIIQRIPEDLLKQARGLELRFDIHKAGVQRIRPTL
DNVRLYCTPVVNLFPHDAIPIRLDGKQDQYLLLPAEYDSQQCGVFSVDRVTGWKPGGMGY
EEYVPFESFEHDASFDVPVARPHYSVRQQPSLLGEGQETWLSFGLRNLDQHETLSIELTC
TNQNLPRQLKLGDICKPSEDTPEFLSFRNISAVTPSYAPPLQRDYLWKLISNMSLNYLSL
ANVEALKVILETYDLPRYYDKHAENVSRRRLGGLTHIAHQHVDRLHRGLPVRGVRTELTM
NQDGFIGEGDLFLFASVLNEFFALYASLNSYHELRVQSTQGEVYQWTPRMGQQPLL
NT seq 1791 nt   +upstreamnt  +downstreamnt
atgtctttcaaccactactaccagagcgagctcaccgccctgcgccagctgggcaagcgc
ttcgctgagcgcagtccggcactggcgccattcctcgggcaggccgggcgcgatccggat
gtcgagcggctgctcgaaggtttcgcctttctcaccgggcggctgcggcagaagctcgat
gacgagctgccggagctgacccactcgctgatgcatctgttgtggccgaactacatgcgc
ccgctgccggccttcagcatgctgcagttcgatccgctgaagcgacccggcccggcgctg
acggtgccgcgcaatacgccggtggaatccaatccggtgcagggcgtgagctgctgcttt
cgtaccgcctacgccaccgaggtgctgccgctggcgttgcaggcgctggagtattcggtc
aagggcaccggggcgctgctcagcctgcgcttgcagatgagcgccgatggccatctcggc
gagatcggtctcaaccatctgcgcctgcacctggcaggcgagccctatatcagccagctg
ctctacctgagcctgttgcggcatctgggcggcatcgagctggtgccgctggacgcgcag
ggtcatccgctgaccggtccggatggccgaccgctgacgcccttgcagctcaacgccaag
caggtcgaaccggtgggattcgccgaggatgaggcgctgatcccctacccgctcaataca
ttccgcggctatcgctacctgcaggaatatttcgccttcccggacaagtttctcttcgtc
gaccttaagggcctggagatcattcaacgcatccccgaggatttgctcaagcaggcccgc
ggcctggagctgcgcttcgacattcacaaggccggcgtacagcgcatccgcccgacgctg
gacaacgtgcgtctgtactgtacgccggtggtcaacctgttcccgcacgatgccatcccg
atccgcctggacggcaagcaggaccagtacctgctgctgccagcagagtatgactcgcag
cagtgcggcgtgttctcggtggaccgggtgaccggctggaaacccggcggcatgggctac
gaagaatacgtgccgttcgaatccttcgagcacgacgccagcttcgatgtgccggtggcg
cgcccgcactacagcgtgcgccagcaaccttcgctgctcggagaagggcaggaaacctgg
ctcagcttcggcctgcgcaacctcgaccagcacgagacgctgtccatcgagctgacctgt
accaaccagaacctgccgcgccagctgaagctcggcgacatctgcaagcccagcgaagac
acgccggaattcctcagcttccgcaacatctcggcggtcaccccgagctacgcgccgccg
ctgcagcgtgactatctgtggaagctgatcagcaacatgtcgctgaactacctgtcgctg
gccaacgtcgaggcgctcaaggtgatcctcgagacctacgacctgccgcgctattacgac
aagcacgccgagaacgtcagccggcggcgcctcggcggcctgactcacatcgcccaccag
cacgtcgatcgcctgcatcgcgggctgccggtgcgcggcgtacgcaccgaactgaccatg
aaccaggacggcttcatcggtgagggcgatctgttcctcttcgcctcggtgctcaacgaa
ttcttcgccctctacgccagcctcaactcatatcacgagctgcgcgtgcagagcacacag
ggagaggtgtaccaatggacgccgcgcatgggtcagcaaccgctgctctga

DBGET integrated database retrieval system