KEGG   Pseudomonas stutzeri CCUG 29243: A458_00700
Entry
A458_00700        CDS       T02168                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc02025  Biofilm formation - Pseudomonas aeruginosa
Brite
KEGG Orthology (KO) [BR:psc00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    A458_00700
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psc02044]
    A458_00700
Secretion system [BR:psc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A458_00700
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFM31408
UniProt: I4CMV1
Position
complement(141515..142021)
AA seq 168 aa
MAKEGSVAPKERINVTFKPATGNAQEEVELPLKLMVLGDFTQRADDRKIEDRKPIAIDKN
SFDEVLAKQELNLTFGVPNRLQDEQTDDELAVQLRINSMKDFNPANLVEQVPELKKLMEL
RDALVALKGPLGNAPAFRKAIESVLADDDSRDRVLGELGLAAKEKLDA
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccaaagaaggctcggttgcacccaaggaacgcatcaacgtcacgttcaagccagcc
accggcaatgctcaggaagaggtcgagctgcccctcaagctgatggtgctgggcgatttc
acccagcgcgccgacgatcgcaagatcgaggaccgcaagcccatcgccatcgacaagaac
agcttcgacgaggtcctggccaagcaggagctgaacctgaccttcggcgtgccgaaccgt
ctgcaggacgagcagaccgatgacgagctggccgtacagctgcgcatcaactcgatgaag
gacttcaacccggccaatctggtcgagcaggtccccgaattgaagaaactgatggaactg
cgcgacgccctggtcgccctgaagggcccgcttggcaatgccccggctttccgcaaggcc
atcgaaagcgtactcgccgacgacgattcgcgtgaccgcgtactcggcgagctgggcctg
gcggccaaagagaagctggacgcctga

DBGET integrated database retrieval system