KEGG   Pseudomonas stutzeri CCUG 29243: A458_01850Help
Entry
A458_01850        CDS       T02168                                 

Definition
(GenBank) short chain dehydrogenase/reductase family oxidoreductase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00030  Pentose phosphate pathway
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A458_01850
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     A458_01850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: AFM31626
UniProt: I4CNG9
Position
394523..395290
Genome map
AA seq 255 aa AA seqDB search
MRLQNQVALVTGSTHGIGLGIAVRLAEEGADVVINGREEDDEARASLEQVRAVGRRVCFI
AADVSQVEQCQRLVRESVERMGRLDILVNNAGVQAHAAFLDAEEDDYDRVLDVNLRGPFF
LAQAFARYLREQGRGGRIINNSSVHEELPHPNFTAYCASKGGLKMLMRNIAIELAPLGIT
VNNVAPGAVETPINRELMNQPEKLASLLQNIPVGRLGRPRDVAGVVAFLASPDADYITGT
TLVVDGGLLWNYSEQ
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgcttgcagaatcaggtggctctggtcaccggcagtactcacggcatcggcctcggc
atcgccgtgcgcctggccgaggagggggccgacgtggtcatcaacggtcgcgaggaagat
gacgaggcccgtgcgagcctcgagcaagtacgcgccgtggggcggcgggtctgcttcatc
gccgcggacgtcagccaggtcgagcaatgccagcggctggtgcgcgagagcgtcgagcgc
atgggccgcctggatatcctggtgaacaacgccggtgtgcaggcgcacgccgcatttctc
gacgccgaggaggacgactacgaccgggtactcgacgtcaacctgcgcgggccgttcttc
ctcgcccaggcctttgcccgctatctgcgcgagcaaggccgtggcgggcggatcatcaac
aacagttcggtgcacgaggagttgccgcaccccaacttcaccgcctactgtgcgagcaag
ggcgggctgaagatgctcatgcgcaacatcgccatcgaactcgcgccgctgggcatcacg
gtgaacaacgtggcgccgggcgcagtggaaacgccgatcaatcgcgagctgatgaaccag
ccggagaagctcgccagcctgctgcagaacatccccgtcggacgcctcggcaggccacgc
gatgtggccggggtcgtcgcctttctggcttctccggatgccgactacatcaccgggact
accctggtggtcgatggcggtctgttatggaattacagcgaacaatga

DBGET integrated database retrieval system