KEGG   Pseudomonas stutzeri CCUG 29243: A458_04105Help
Entry
A458_04105        CDS       T02168                                 

Definition
(GenBank) dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00790  Folate biosynthesis
psc01100  Metabolic pathways
Module
psc_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    A458_04105
Enzymes [BR:psc01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     A458_04105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: AFM32073
UniProt: I4CPR6
Position
916056..916907
Genome map
AA seq 283 aa AA seqDB search
MTESLSPARLVCGSRVLDLSRPHVMGILNVTPDSFSDGGRFAEREAALRHAEAMAVAGAT
LIDVGGESTRPGARAVSPTEELERVAPVVEMIARELDVVVSVDTSTPAVIRECARLGAGL
INDVRSLQRDGALDAAVDAGLPVCLMHMRGEPGDMQRDPRYDDVVEEVCSFLEQRMGACA
AAGIPLERIVLDPGFGFAKTLNHNLVLFRRMEVLHRLGRPLLVGVSRKSMIGAVLGRPVD
ERLYGSLALAALAVGKGAQIVRVHDVAETVDVVRMIAAVQAAQ
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaatctctttcccccgctcggctggtatgtggcagccgggttctcgatctttcc
cgtcctcatgtgatggggattctcaatgtcacacccgattctttctctgatggcggtcgc
tttgccgagcgcgaggcagccctgaggcatgccgaagcaatggccgtggctggggctacg
ctgatcgatgttggtggcgagtctacgcgccctggcgcgcgcgccgtctcgccgaccgag
gagctggagcgggtcgcaccggtcgtagagatgatcgcgcgggagctcgacgtggtcgtt
tcggtggatacgtccacgcccgcagtcatccgcgagtgtgcgcggctgggcgctgggctg
atcaacgacgtgcgctcgctgcagcgcgacggtgcgctggatgccgcggttgatgctggc
ttgccggtctgcctcatgcacatgcgcggcgagccaggtgatatgcagagggatccccgc
tacgacgacgttgtggaggaggtttgttcgtttcttgagcagcgaatgggtgcgtgtgct
gcggcgggaatcccgctcgagcgcatcgtcctcgatcccggcttcggcttcgccaagacg
ctgaaccataatcttgtgctgttcaggcgtatggaggtactgcatcggctgggtcggcca
ttgctggtcggtgtttcgcgcaagagcatgatcggggccgtgctgggtcggccagttgat
gagcgcttgtacggcagtctggctttggcggcgctcgccgtaggcaagggcgcgcaaatt
gtgcgcgtccatgacgttgccgagacggttgatgtagttcgaatgattgctgcagtgcag
gcggcgcaatag

DBGET integrated database retrieval system