KEGG   Pseudomonas stutzeri CCUG 29243: A458_04770Help
Entry
A458_04770        CDS       T02168                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00471  D-Glutamine and D-glutamate metabolism
psc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    A458_04770
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:psc01011]
    A458_04770
Enzymes [BR:psc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     A458_04770
Peptidoglycan biosynthesis and degradation proteins [BR:psc01011]
 Precursor biosynthesis
  Racemase
   A458_04770
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: AFM32204
UniProt: I4CQ47
Position
1072283..1073077
Genome map
AA seq 264 aa AA seqDB search
MADCAAPVGVFDSGVGGLSVLREIRQRLPHESLLYLADSAHVPYGEKSPDYIRERCRVIA
AFFVEKGAKALVVACNTATAAGVTELRELYPQLPIIAMEPAVKPAAQATRSGVVGVLATT
GTLKSARFAALLDRFAADVRVITQPCPGLVERIEAGDLNSAETRAMLMGWVEPLLAQGCD
TLILGCTHYPFIRPLLSELLPGNVRLIDTGAAVARHLRDLLAERHLLASGVASERFYCSG
DPRRMASVLPILWGENAKVEFFPR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggctgactgcgcagcaccggtcggcgtcttcgactccggagtaggcgggctctcggtg
ctgcgtgagatccggcagcgcctgccgcacgagtcgctgctctatctcgccgacagcgcc
catgtcccctatggcgaaaagagcccggactacatccgtgagcgctgccgtgtcattgcg
gccttttttgtcgagaagggcgcgaaggcgctggtggtggcctgcaatactgcgaccgcc
gctggcgtcaccgaattgcgcgagctgtatccgcaattgccgatcatcgccatggaaccg
gccgtcaagcccgccgcccaggccacgcggagtggtgtcgtcggcgtgctggcgaccacc
ggaacgctgaagagcgcccgctttgccgcgttgctcgatcgctttgccgcagatgtacgg
gtgatcactcagccgtgccccggcttggtcgagcgcatcgaggcaggcgatctgaacagt
gccgaaacgcgcgccatgttgatggggtgggtcgagccgctgttggcacaaggctgcgac
acgctgattctgggttgcacgcattatccctttataaggccgctgctcagcgagctactg
cctggaaacgtccgcctgattgataccggagcagccgtcgcgcgacacttgcgcgatctg
ctggcagagcgccatctgctcgccagcggggtggcctccgagcgtttctattgcagcggc
gatccgcggcgaatggccagcgtgttgcctatactttggggcgaaaacgcgaaagtcgag
ttttttccccgctag

DBGET integrated database retrieval system