KEGG   Pseudomonas stutzeri CCUG 29243: A458_06700
Entry
A458_06700        CDS       T02168                                 

Definition
(GenBank) trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00626  Naphthalene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    A458_06700
Enzymes [BR:psc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     A458_06700
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AFM32586
UniProt: I4CR79
Position
complement(1468569..1469573)
AA seq 334 aa
MSNKTMKPARLTAEDIHGVWAIMPTPATPDASNWRSTNTVDLNETARIVEELIAAGVNGI
LSMGTFGECATLTWEEKRDYVSTIVETIRGRVPYFCGTTALNTREVIRQTREFMDMGASG
TMLGVPMWVKMDLPTAVQFYRDVAEAVPEAAIAIYANPEAFKFDFPRPFWAEMSKIPQVV
TAKYLGIGMLDLDLKLAPNIRFLPHEDDYYAAARINPERITAFWSSGSMCGPATAIMLRD
AVDQAKSSGDWIKAKAISDDMRAADSTLFPRGDFSEFSKYNIGLEKARMDAAGWLTAGPC
RPPYNIVPEDYIAGALKSGKAWAALHAKYSKELK
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgtcgaataaaactatgaaaccagcgcgtcttactgccgaggatatccatggtgtctgg
gctattatgccaacgccggctactccggatgcttctaactggcgcagcactaacacagtt
gacttaaacgagactgctcgcatagttgaagaactgattgcggctggtgtcaacggaatt
ttaagtatgggcacttttggcgagtgcgctacgttgacctgggaggaaaaacgtgactat
gtttcgacgattgtcgaaaccattcgtggtcgcgtgccttatttctgcggcaccacggcc
ttgaatacccgcgaagtcatccgccaaactcgtgagtttatggatatgggcgccagcggt
accatgctcggtgtcccaatgtgggtgaagatggacctgcccacagcggtccagttctat
cgtgatgttgcagaggcggtaccggaggctgccattgcgatttacgctaaccctgaagcc
ttcaagttcgacttccctcgccccttctgggcagaaatgtccaaaattccgcaggtagta
actgccaaatatctaggcatcggaatgcttgacttggacctgaaattggcacccaacatc
cgcttccttccacacgaggatgactattacgcggccgcacgcatcaatcctgagcgcatt
accgcgttctggtcaagcggctccatgtgcggcccggctaccgccatcatgttgcgtgat
gcagtggatcaggccaagagcagcggtgactggatcaaggccaaagccatctccgatgac
atgcgcgcagccgattcgacattgtttccgcgtggcgacttttcggagttctcgaaatac
aacatcggacttgaaaaagcacgcatggatgcagctggctggctcacagctggaccatgc
cgtccgccctataacatcgtcccagaagactatattgctggcgcccttaagtcaggcaaa
gcttgggccgcactgcatgctaaatacagcaaggaattgaagtag

DBGET integrated database retrieval system