KEGG   Pseudomonas stutzeri CCUG 29243: A458_06720
Entry
A458_06720        CDS       T02168                                 

Definition
(GenBank) naphthalene 1,2-dioxygenase iron sulfur protein component small subunit
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00624  Polycyclic aromatic hydrocarbon degradation
psc00626  Naphthalene degradation
psc00627  Aminobenzoate degradation
psc00633  Nitrotoluene degradation
psc00642  Ethylbenzene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A458_06720
   00633 Nitrotoluene degradation
    A458_06720
   00642 Ethylbenzene degradation
    A458_06720
   00626 Naphthalene degradation
    A458_06720
   00624 Polycyclic aromatic hydrocarbon degradation
    A458_06720
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     A458_06720
    1.14.12.23  nitroarene dioxygenase
     A458_06720
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     A458_06720
SSDB
Motif
Pfam: Ring_hydroxyl_B ACP_PD
Other DBs
NCBI-ProteinID: AFM32590
UniProt: I4CR83
Position
complement(1473264..1473845)
AA seq 193 aa
MMINIQEDKLVSAHDAEEFLRFLNSGDEALQQEATTLLTREAHLLDIQAYRAWLEHCVDS
EVKYQIISRELRSASERRYQLNETMNIFNENYEQLEVRVAHQLDPQNWGNSPKVRFTRFI
TNIQAAMDENEDLLHIRSNLIVHRARRGNQVDVFYATREDKWKRGEDGARKLVQRLIDYP
ERTFQTHNVMIFM
NT seq 582 nt   +upstreamnt  +downstreamnt
atgatgattaatattcaagaagacaagcttgtctccgcccacgatgccgaagagtttctt
cgtttcttaaattccggcgacgaggctttgcaacaagaagctaccacgttgctaacccgg
gaagcgcatcttttagacattcaggcttaccgcgcctggttagagcactgcgtggactca
gaggtgaaatatcagattatctcacgcgaactgcgctcagcttccgagcgccgttaccag
ctcaatgaaaccatgaacattttcaacgagaattatgaacaactggaagttcgcgtagcg
catcaactggatccgcaaaactggggcaatagtccaaaggtgcgctttactcgtttcatc
acaaatatccaggctgcaatggacgaaaatgaagatttgcttcacattcgctccaaccta
attgttcaccgagcacgacgcggcaatcaagtcgatgtcttctatgccactcgggaggat
aaatggaagcgcggcgaagatggagcgcgtaagttggtccaacgattgattgattatcca
gagcgcacattccagacgcacaatgtgatgatctttatgtga

DBGET integrated database retrieval system