KEGG   Pseudomonas stutzeri CCUG 29243: A458_06725
Entry
A458_06725        CDS       T02168                                 

Definition
(GenBank) napthalene dioxygenase iron sulfur protein large subunit
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00624  Polycyclic aromatic hydrocarbon degradation
psc00626  Naphthalene degradation
psc00627  Aminobenzoate degradation
psc00633  Nitrotoluene degradation
psc00642  Ethylbenzene degradation
psc01100  Metabolic pathways
psc01120  Microbial metabolism in diverse environments
psc01220  Degradation of aromatic compounds
Module
psc_M00534  Naphthalene degradation, naphthalene => salicylate
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    A458_06725
   00633 Nitrotoluene degradation
    A458_06725
   00642 Ethylbenzene degradation
    A458_06725
   00626 Naphthalene degradation
    A458_06725
   00624 Polycyclic aromatic hydrocarbon degradation
    A458_06725
Enzymes [BR:psc01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     A458_06725
    1.14.12.23  nitroarene dioxygenase
     A458_06725
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     A458_06725
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske
Other DBs
NCBI-ProteinID: AFM32591
UniProt: I4CR84
Position
complement(1473861..1475210)
AA seq 449 aa
MNYKNKTLVTESGLTQKHLIHGDEELFQRELETIFARNWLFLTHDSLIPSPGDYVTAKMG
VDEVIVSRQNDGSIRAFLNVCRHRGKTLVHAEAGNAKGFVCSYHGWGFGANGELQSVPFE
KELYGEALDKKCMGLKEVARVESFHGFIYGCFDEEAPSLKDYMGDAGWYWEPMFKHSGGL
ELIGPPGKVIIKANWKAPAENFVGDAYHVGWTHASSLRTGQSVFTSLAGNAALPPEGAGL
QMTSKYGSGMGVLWDGYSGVHSADLVPELMAFGGAKQERLNKEIGEVRARIYRSHLNGTV
FPNNSFLTCSGVFKVWHPIDANTTEVWTYAMVEKDMPEDLKRRLVDAVQRTFGPAGFWES
DDNDNMETESQNAKKYQSRDGDLISNLGFGGDVYGDEVYPGVVGKSAIGETSYRGFYRAY
GAHISSSSWAEFEDASKNWHTELTKTTDR
NT seq 1350 nt   +upstreamnt  +downstreamnt
atgaattacaaaaataaaaccttggtgactgaatctgggctgacccaaaaacacctgatt
catggcgacgaagaacttttccagcgcgaactggaaaccatttttgctcggaactggctt
ttcctgactcatgacagcctaattccatcccctggcgactatgttacggcaaaaatgggg
gttgatgaggttatcgtctccaggcagaacgacggttcgattcgtgctttcctgaacgtt
tgtcgtcaccgtggcaagacgctggtacacgcagaagcaggtaatgctaaaggtttcgtt
tgcagctatcacggctggggcttcggcgctaacggtgaactgcagagcgtcccgtttgaa
aaagaactgtatggcgaggcgctcgacaagaaatgtatgggattgaaagaagtcgctcgt
gtagagagcttccatggcttcatctatggttgcttcgatgaggaagccccttctctcaaa
gactacatgggggacgctggctggtactgggagcctatgtttaagcattccggagggcta
gaactgatcggtcctccaggaaaggtcataatcaaggctaactggaaagcgcccgcggaa
aactttgtgggggatgcgtaccacgtgggttggacgcatgcgtcttcgcttcgcacaggg
cagtcggtcttcacgtcgttagctggcaacgcagctttgcccccagaaggtgcaggtctg
caaatgacctccaaatacggcagcggcatgggtgtgttgtgggacggatattcaggcgtg
cacagcgcagacctggttccggaattgatggccttcggcggtgctaagcaggaacggctg
aacaaagaaattggcgaggttcgcgcacgaatctatcgtagccacctcaacggcaccgtt
ttcccgaacaacagttttctgacctgctcgggtgtcttcaaggtatggcacccgatcgac
gcaaataccactgaggtatggacctacgccatggtcgaaaaagacatgcccgaggatctc
aagcgccgcttggtcgacgcggttcagagaacgtttgggcctgctggcttctgggaaagc
gatgacaatgacaatatggaaacggaatcgcaaaacgccaagaaatatcagtccagggat
ggcgatctgatttccaacctgggtttcggcggggacgtatacggcgacgaggtttatcct
ggcgtcgtcggcaaatcggcgattggcgagaccagttatcgtggcttctatcgggcttac
ggcgcgcacatcagcagctctagctgggctgaattcgaggatgcctctaaaaattggcat
accgaactgacaaagactactgatcgctaa

DBGET integrated database retrieval system