KEGG   Pseudomonas stutzeri CCUG 29243: A458_07125Help
Entry
A458_07125        CDS       T02168                                 

Definition
(GenBank) cytochrome d terminal oxidase polypeptide subunit II
  KO
K00426  cytochrome bd ubiquinol oxidase subunit II [EC:7.1.1.7]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00190  Oxidative phosphorylation
psc02020  Two-component system
Module
psc_M00153  Cytochrome bd ubiquinol oxidase
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    A458_07125
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A458_07125
Enzymes [BR:psc01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.7  ubiquinol oxidase (electrogenic, proton-motive force generating)
     A458_07125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cyt_bd_oxida_II
Motif
Other DBs
NCBI-ProteinID: AFM32671
UniProt: I4CRG4
Position
1539132..1540274
Genome map
AA seq 380 aa AA seqDB search
MFDYEVLKLIWWVLIGVLLIGFALTDGFDMGAMALMPFVGKTDNERRVAINTIAPHWDGN
QVWFITAGGALFAAWPMVYAVAFSGLYWAMLLVLFALFCRPVGFDYRSKVEDPRWRSAWD
WALFVGGAVPALVFGVAFGNLFLGLPFQLDELMRSTYQGSFFALLNPFALLCGIVSLSML
SAHGGAWLMLRTDGALAERSRQATRLCVLVFLFGFVAAGVWLALGIQGFSQLSVSDPGAA
LNPLLDKQVAQDNIGWLANYGLYPVTLIAPAAGILGALLALLGSSRNSGGVSFVGTSLMI
VGSICTAGFALFPFVFPSSLDPASSLTIWDAVSSQKTLGIMFVVACIFVPLILCYTLWSY
VRMWGRLTQKTIEANPHGLY
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttcgattacgaagtgctcaaactcatctggtgggtgctgatcggcgtgttgctgatc
ggcttcgccctgaccgatggcttcgacatgggcgccatggcactgatgcccttcgtcggc
aagaccgacaacgagcgacgcgtggcgatcaacaccatcgcgccacactgggatggcaac
caagtgtggttcattaccgccggtggtgcgctgttcgctgcctggccgatggtctatgcg
gtggcattttccggcctgtactgggcgatgctgctggtgctgtttgcgctgttctgccgc
ccggtgggcttcgactatcgcagcaaggtggaagacccgcgctggcgcagcgcctgggac
tgggcgctgttcgtcggcggtgcggtgccggcgctggtgttcggcgtggccttcggcaac
ctgttcctcggcctgccgttccagctggacgagctgatgcgctcgacctatcagggctcg
ttcttcgcgctgctcaacccgttcgcgctgctctgcggcatcgtcagcctgagcatgctc
agcgcccacggtggcgcctggctgatgctgcgcaccgacggcgcgctggctgagcgctcg
cggcaggccacgcgcctgtgcgtgctggtgttcctgttcggcttcgtcgcggcgggtgtc
tggctggcgctgggcattcagggcttcagccagctgtcggtcagcgatccgggcgccgcg
ctcaatccgctgctggacaagcaggtggcccaggacaatatcggctggttggccaactac
ggcctctatccggtcaccttgatcgcgccggccgcgggcatcctcggggcgttgctggcg
ctgctcggctccagccgcaacagcggtggggtgagcttcgtcggaaccagtctgatgatc
gtcggcagcatctgtaccgcgggctttgcgctgtttcccttcgtcttcccgtcgagcctc
gatccggcctcgagcctgaccatctgggatgcggtctcaagtcagaagacgctgggcatc
atgttcgttgtggcctgcatcttcgtgccgctgatcctctgctacacgctgtggagctac
gtgcgcatgtggggccggctcacccagaaaaccatcgaagccaacccccacgggctgtac
tga

DBGET integrated database retrieval system