KEGG   Pseudomonas stutzeri CCUG 29243: A458_07205Help
Entry
A458_07205        CDS       T02168                                 

Definition
(GenBank) cobyric acid synthase
  KO
K02232  adenosylcobyric acid synthase [EC:6.3.5.10]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00860  Porphyrin and chlorophyll metabolism
psc01100  Metabolic pathways
Module
psc_M00122  Cobalamin biosynthesis, cobinamide => cobalamin
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A458_07205
Enzymes [BR:psc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.10  adenosylcobyric acid synthase (glutamine-hydrolysing)
     A458_07205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GATase_3 CbiA AAA_26 GATase
Motif
Other DBs
NCBI-ProteinID: AFM32687
UniProt: I4CRI0
Position
1553485..1554942
Genome map
AA seq 485 aa AA seqDB search
MTTLMVQGTTSDAGKSTLVTALCRWLARQGVAVVPFKPQNMALNSAVTADGGEIGRAQAV
QAQAANLAPHTDMNPVLLKPNSDIGAQVIIHGRAVTSMDAAAYHDYKRVAMQAVLDSHQR
LSAAYRVVMVEGAGSPAEINLRAGDIANMGFAEAVDCPVILIADIDKGGVFAHLVGTLAL
LSESEQARVQGFVINRFRGDIALLQPGLDWLEQRTGKPVLGVLPYLMDFHLEAEDAIDVR
QSGKAGDALKVVVPVLPRISNHTDFDPLRLHPQVDLQFVGPGQPVPPADLIILPGSKSVR
ADLTWLRANGWEAAIQKHLRYGGKLLGICGGLQMLGTRIADPLGLEGPAGESEALGLLDF
ATVLEADKQLRNVTGRLLPSGVPVSGYEIHAGVSSGPALEQPAVQLDDGRFDGAISADEQ
VLGTYLHGLFEGPEACAALLRWAGLDAVETVDYHALRERDIERLADLVETHLDTARLRAL
CGLED
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgctgatggtgcagggcaccacctccgacgccggcaagagcacgctggtgacg
gcgctgtgccgctggttggcacgccagggggttgccgtcgtgccgttcaagccgcagaac
atggcgctcaacagcgcggtgactgcagatggcggcgaaatcggcagggctcaggccgta
caggcgcaggcggcgaaccttgcgccgcacaccgacatgaatccggtgctcttgaagccc
aacagcgacatcggcgcccaggtgatcatccatggtcgcgcggtgaccagcatggatgcc
gccgcctaccatgactacaagcgcgtggcgatgcaggcggtgctcgactcgcaccagcgg
ctgtccgcggcttatcgcgtggtgatggtcgagggcgccggttcgcctgcggagatcaat
ctgcgcgccggcgatatcgccaacatgggcttcgccgaggcggtggattgcccggtgatc
ctgatcgccgatatcgacaagggtggggtgttcgcccatctggtcggcaccctggcgttg
ctctcggaaagcgagcaggcgcgggttcagggcttcgtcatcaaccgttttcgtggcgac
attgcgctgttgcagcccggtctcgactggctggaacaacgcaccggcaagccggtactg
ggcgtgctgccgtacctgatggatttccatctggaagcggaggatgccatcgacgtgcgc
cagtccggcaaggccggcgatgcgctgaaggtggtggtgccggtgctgccgcgcatcagc
aaccacaccgacttcgacccgctgcgcctgcacccgcaggtcgacctgcagttcgtcggt
cccgggcagccggtgccgcctgccgatctgatcatcctgcccggctcgaaaagcgtacgc
gccgacctcacctggctgcgcgccaacggctgggaagcagcaatccagaagcacctgcgc
tacggtggcaaattgctgggcatctgtggcggcctgcagatgctcggcacgcgcattgct
gatccgctcgggctggaaggtccggcgggggagagcgaggcgcttgggctgctggacttc
gccactgtactcgaagccgacaagcagctgcgtaacgtcaccggccggttgctgccgagc
ggcgtgccggtcagcggctacgagattcatgccggcgtcagcagcggcccggccctggag
cagccagcggtgcagctcgacgatggccgcttcgatggcgccatcagcgccgacgagcag
gtgctcggcacatatctgcacggcctgttcgaaggccccgaggcctgtgccgccctgctg
cgctgggcaggcctcgatgcagtggaaacggtcgactaccacgcgctgcgcgagcgcgac
atcgagcgcctcgccgacttggtcgagacacatctggataccgcgcggttacgcgcgctc
tgcgggctggaagactga

DBGET integrated database retrieval system