KEGG   Pseudomonas stutzeri CCUG 29243: A458_09540Help
Entry
A458_09540        CDS       T02168                                 

Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00071  Fatty acid degradation
psc00280  Valine, leucine and isoleucine degradation
psc00281  Geraniol degradation
psc00310  Lysine degradation
psc00360  Phenylalanine metabolism
psc00362  Benzoate degradation
psc00380  Tryptophan metabolism
psc00410  beta-Alanine metabolism
psc00627  Aminobenzoate degradation
psc00640  Propanoate metabolism
psc00650  Butanoate metabolism
psc00903  Limonene and pinene degradation
psc00930  Caprolactam degradation
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01212  Fatty acid metabolism
Module
psc_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    A458_09540
   00650 Butanoate metabolism
    A458_09540
  Lipid metabolism
   00071 Fatty acid degradation
    A458_09540
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A458_09540
   00310 Lysine degradation
    A458_09540
   00360 Phenylalanine metabolism
    A458_09540
   00380 Tryptophan metabolism
    A458_09540
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A458_09540
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    A458_09540
   00281 Geraniol degradation
    A458_09540
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A458_09540
   00627 Aminobenzoate degradation
    A458_09540
   00930 Caprolactam degradation
    A458_09540
Enzymes [BR:psc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     A458_09540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Herpes_ori_bp Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: AFM33152
UniProt: I4CSU5
Position
2065920..2066732
Genome map
AA seq 270 aa AA seqDB search
MTEYKAFRVELADKIARVVINRPEKINAMDAAFWSEIIDIFNWIDATDEVRVVVLSGAGD
HFSSGIDLQMLASVGSQLGNDVGRNAEQLRRKILSLQASFNAVDNCRKPVIAAIQGYCLG
GAIDLISACDMRYSTADAKFSIKEIDMGMAADVGTLQRLPRIIGDGMMRELAFTGRTISG
EEARSIGLVNRTYADQQMLMDAVLELARDIASKSPLAIRGTKEMIRYMRDHRVDDGLEYI
ATWNAAMLQSADIKVAIAAHMSKQKPDFAD
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgaatacaaagccttccgcgtagagttggcagacaagattgcccgcgtcgtgatc
aatcggcctgaaaagatcaatgcgatggacgctgcgttctggtcggaaatcatcgatatc
ttcaactggatcgatgcaaccgacgaagtacgcgtagtcgtcctcagtggcgccggtgac
cacttctcttccggtatagacctgcagatgctggcttcggtcggcagccagcttggcaac
gacgtcggccgcaatgccgagcagctgcggcgcaagatcctctctctgcaggcatcgttc
aatgccgttgacaactgccgcaagccggtcatagctgcgattcagggttactgtctgggc
ggcgccattgatctgatctccgcttgcgacatgcgttacagcacggcggacgcgaaattc
tcgatcaaagaaatcgacatgggcatggcggccgatgtcggcaccttgcagcgcctgcct
cgcatcatcggcgatggcatgatgcgcgaactggcctttaccggccgcaccatcagcggc
gaggaagcgcgcagcatcgggctggtcaatcgcacctatgccgatcagcagatgctgatg
gacgccgtgctggagctggcccgtgacatcgccagcaaatcaccgctcgccattcgcggc
accaaggagatgatccgttacatgcgcgatcaccgggtcgacgatggtctcgagtacatc
gccacctggaatgcggccatgctgcagtcggccgacatcaaggtcgccatcgccgctcat
atgagcaaacagaagccggactttgccgactga

DBGET integrated database retrieval system