KEGG   Pseudomonas stutzeri CCUG 29243: A458_11250Help
Entry
A458_11250        CDS       T02168                                 

Definition
(GenBank) 3-ketoacyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00071  Fatty acid degradation
psc00072  Synthesis and degradation of ketone bodies
psc00280  Valine, leucine and isoleucine degradation
psc00310  Lysine degradation
psc00362  Benzoate degradation
psc00380  Tryptophan metabolism
psc00620  Pyruvate metabolism
psc00630  Glyoxylate and dicarboxylate metabolism
psc00640  Propanoate metabolism
psc00650  Butanoate metabolism
psc00900  Terpenoid backbone biosynthesis
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
psc01212  Fatty acid metabolism
psc02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A458_11250
   00630 Glyoxylate and dicarboxylate metabolism
    A458_11250
   00640 Propanoate metabolism
    A458_11250
   00650 Butanoate metabolism
    A458_11250
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A458_11250
   00072 Synthesis and degradation of ketone bodies
    A458_11250
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A458_11250
   00310 Lysine degradation
    A458_11250
   00380 Tryptophan metabolism
    A458_11250
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A458_11250
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A458_11250
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A458_11250
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:psc04147]
    A458_11250
Enzymes [BR:psc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A458_11250
Exosome [BR:psc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A458_11250
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFM33487
UniProt: I4CTT0
Position
complement(2467163..2468347)
Genome map
AA seq 394 aa AA seqDB search
MKDDPIVIVSSARTPMGGFQGDLQGMTAWQLGAAAIRAAVERSGLPAENVQDVLMGCVLP
AGQGQAPARQAALSAGLTRATTCTTVNKMCGSGMQTVIMAHDQLLAGSADIVVAGGMESM
SNAPYLLDRARGGYRMGHGRVLDHMFLDGLEDSFDKGRLMGTFAEECADAFGFSREAQDA
YALESLRRAQVAISEGRFAEEIVALEVTQGKQQRQIRDDEQPPKAMPEKIPSLKPAFREG
GTVTAANSSSISDGAAALLLMRRSEAERWGLQPQAVIHGHAAYADAPNLFTTAPIGAIRK
LMERTGWSTEDVDLLEINEAFAVVAMASMRELALDHAKVNVNGGACALGHPIGASGARIL
VTLLSALRARGLRRGVAAICIGGGEATAMAVELI
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgatccgatcgtaatcgtcagcagtgcgcgcacgcccatgggcggttttcag
ggcgacctgcaggggatgaccgcctggcagctcggtgctgccgccatccgcgcggcggtg
gaacgcagcggcctgccggccgagaacgtgcaggacgtgctgatgggctgcgtgctgcct
gccggccagggccaggcaccggcacgtcaggcggcattgagcgccgggctgacccgcgcc
accacctgcaccacggtcaacaagatgtgcggctcgggcatgcagacggtgatcatggcc
cacgaccagctgctcgccgggagtgccgatatcgtcgtcgccggcgggatggaaagcatg
tccaacgcgccttacctgctcgaccgcgcccgtggcggctatcgcatggggcatgggcgg
gtgctcgaccatatgttcctcgacggtctggaagactcgttcgacaaggggcggctgatg
ggcaccttcgccgaggaatgcgccgacgcgttcggcttcagccgtgaagcccaggacgcc
tacgcgctcgagtccctgcgccgcgctcaggtggcgatcagtgaggggcgttttgccgaa
gagatcgttgcgctggaggtcacccagggcaaacagcagcggcagatccgtgatgacgag
cagccgcccaaggcgatgccggaaaagattcccagtctgaagcccgcgttccgcgagggc
ggcacggtgaccgcggccaactccagctcgatttccgatggtgccgccgcgctgctgctg
atgcgccgttccgaagccgagcgctggggcctgcagccacaggcggtgatccacggccac
gcggcctacgctgatgcaccgaatctgttcaccacagcgccgatcggcgcgatccgcaag
ctgatggagcgcaccggctggtccaccgaagacgtggatctgctcgagatcaacgaagcc
ttcgcggtggtcgccatggccagcatgcgcgagttggccttggaccacgccaaggtcaac
gtcaacggcggtgcctgcgcgctcggccatcccatcggtgcctcgggcgcgcggatcctg
gtgacgctgctttcggcccttcgtgcacgtggtctgcgccgtggcgtagcggcgatctgc
attggtggcggcgaagccacggccatggccgtcgaactgatctga

DBGET integrated database retrieval system