KEGG   Pseudomonas stutzeri CCUG 29243: A458_12995Help
Entry
A458_12995        CDS       T02168                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc00010  Glycolysis / Gluconeogenesis
psc00052  Galactose metabolism
psc00500  Starch and sucrose metabolism
psc00520  Amino sugar and nucleotide sugar metabolism
psc00521  Streptomycin biosynthesis
psc01100  Metabolic pathways
psc01110  Biosynthesis of secondary metabolites
psc01120  Microbial metabolism in diverse environments
psc01130  Biosynthesis of antibiotics
psc01200  Carbon metabolism
Module
psc_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
psc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:psc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A458_12995 (glk)
   00052 Galactose metabolism
    A458_12995 (glk)
   00500 Starch and sucrose metabolism
    A458_12995 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    A458_12995 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    A458_12995 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    A458_12995 (glk)
Enzymes [BR:psc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     A458_12995 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AFM33830
UniProt: I4CUS3
Position
complement(2854226..2855188)
Genome map
AA seq 320 aa AA seqDB search
MKTALVGDIGGTNARFALWRDQRIEQIRVIPTADHARPELAILAYLSEVDQPLETLEAVC
LACAGPVGGDLFRFTNNHWQLSREAFCRELGVKELLLINDFTAMALGMTRLHDGERITVC
DGEPEPGRPRLVIGPGTGLGVAGLLPLSGGGWRALPGEGGHICLPVGSEREAAIWAHLHR
SLGHVNAEAVLSGPGLLTLYRACCALDGQQVALDSPAAITKAALAGDAYAAAVLEQFCRW
LGRIVGDNVLTLGARGGVYIVGGVVPRFAEMFLRSGFSEALREKGQMSRYFDRLPVWLVT
APYPGLEGAGVALQPLLEGA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaagacggcgctcgttggagatattggcggtaccaatgcacgtttcgcgctgtggcgc
gaccagcgtatcgagcagattcgcgtgattcccacggccgaccatgcgcggccggagctg
gcgatccttgcgtacctgagtgaagtcgatcagccgctggaaaccctcgaggcggtgtgc
ctcgcctgtgccgggccggtcgggggcgacctgtttcgtttcaccaacaaccattggcag
ctgagccgcgaagccttctgccgcgagctgggcgtgaaggagctgttgctgatcaacgac
ttcaccgccatggccctcggcatgacgcggctgcacgatggtgagcgcatcacggtttgc
gatggcgagcctgaaccgggacggccacgcctggtcataggccccggcaccgggctcgga
gtcgccggattgctgccactgtctggcggcggttggcgcgccttgccgggcgagggcggg
catatctgccttcccgtcggcagcgagcgcgaggcggcgatctgggcgcatctgcatcgt
tcgctcggccatgtaaatgccgaggcagtgctcagcggtccggggctgctgacgctctac
cgcgcatgctgcgcgctggatggacagcaggtggcgctcgattcgcccgcagctatcacc
aaggccgcgctggccggcgatgcctacgccgcggcggtgctggagcagttctgccgctgg
ctggggcgtatcgtcggcgataacgtgctgaccctcggtgcccgcggcggcgtttacatc
gtcggtggcgtggttccgcgtttcgccgagatgttcctgcgcagcggtttcagcgaggcg
ttgcgtgagaaggggcagatgagccgctatttcgatcgcctgccggtctggctggtgacc
gcgccgtatccgggcctcgagggcgcgggcgtggcattgcaaccgttgttggagggagcc
tag

DBGET integrated database retrieval system