KEGG   Pseudomonas stutzeri CCUG 29243: A458_20755Help
Entry
A458_20755        CDS       T02168                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
psc  Pseudomonas stutzeri CCUG 29243
Pathway
psc02025  Biofilm formation - Pseudomonas aeruginosa
psc03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:psc00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    A458_20755
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02025 Biofilm formation - Pseudomonas aeruginosa
    A458_20755
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:psc02044]
    A458_20755
Secretion system [BR:psc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   A458_20755
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: AFM35366
UniProt: I4CZ59
Position
complement(4470885..4471403)
Genome map
AA seq 172 aa AA seqDB search
MPTPAYLSLEGTKQGLITAGTFTEDSVGNIFQEGHEDQILVQAFQHQVIIPRDPQSGQPT
GQRVHKPLMITKVFDKSSPLIFNALTSGERLNKCRLEWYRTSSTGTQEHYFTIELEDAVI
VDVQSRMPNCQDPNMSHFTHLEDVYFTYRKIVWTHEVSGTSGSDDWRTPIAG
NT seq 519 nt NT seq  +upstreamnt  +downstreamnt
atgccaacacccgcgtatctgtccctcgaaggcaccaagcaaggcctgatcaccgccggc
accttcaccgaggactcggttggcaacatcttccaggaaggccatgaggaccagatcctg
gtgcaggccttccagcatcaggtcatcatcccgcgtgacccgcagtccggccagccgaca
ggccagcgcgtacacaagccgctgatgatcaccaaggtattcgataagtcgtcgccgctg
atcttcaacgctctgacttccggcgagcgcctgaacaagtgccgtctggagtggtaccgc
acctcgtccaccggcacccaggaacactacttcaccatcgaactggaagatgcggtgatc
gtcgatgtgcagtcgcgcatgcccaactgccaggacccgaacatgtcccatttcactcat
ctggaagatgtgtacttcacctaccgcaagatcgtctggacccacgaggtgtccggcacc
tccggctccgacgactggcgcaccccgatcgctggctga

DBGET integrated database retrieval system