KEGG   Phialocephala scopiformis: LY89DRAFT_582902
Entry
LY89DRAFT_582902  CDS       T04865                                 

Definition
(RefSeq) nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
psco  Phialocephala scopiformis
Pathway
psco00910  Nitrogen metabolism
psco01100  Metabolic pathways
Module
psco_M00531  Assimilatory nitrate reduction, nitrate => ammonia
psco_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    LY89DRAFT_582902
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     LY89DRAFT_582902
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Fer2_BFD Pyr_redox Rieske_2 Rieske NIR_SIR_ferr NAD_binding_9 Rubredoxin_C Pyr_redox_3 HI0933_like K_oxygenase
Other DBs
NCBI-GeneID: 28818914
NCBI-ProteinID: XP_018072233
JGI: 582902
UniProt: A0A194XCH6
Position
Unknown
AA seq 1070 aa
MTAEIPSVSNDGGSKRKRVVVVGLGMVGITFVEKLMKMDVKRREYDVIVIGEEPHLAYNR
VGLTSFFEHRDVERLYMQTEAWYKAFPEGSLSYHLNSLVTEIDSEKKFVITAKGDTIECD
ILVLATGSNAILPKSIVGYDATGVFVYRTIEDLQKLIAFSATKKGKTGIVVGGGLLGLEA
AKAMMDLEEFGKIKVIESFPYVLGRQVDPEGGAMVVEQVRDLGVDLILGKMVNKFLTDEN
NGVTGVEFEDGHKVDGACVCVAIGVSPRDELARKSGLECGPRGGIIVGDDLQTSVKDIYA
IGECANWANMCYGLYAPGIEMAEILAFNLTDAKLRSPRSLTTPDMSTKLKLLGIGVASFG
DAFADQFGPQWLPGKRQDKEIEKTLVKVLTYKDPFNHVYKKYLFTKDGKYLLGGMMVGDT
NDYVKLLPMSKQHKQLEMAPGELIIGKPGGEDDANDLPDEAQICSCNNVTRGDITKTIKD
GTCKTVNEIKICTKAGTGCGGCIPLVTSIFNKTMIDMGQEVKNHLCSHFAYSRAELFHVV
MVKKLDSFEAIMKESGVPGSLGCELCKPAVASILASLYNKPIADPGRRGLQDTNDKFLAN
IQRNGTFSVIPRVAGGEITPKKLAAIASVAQKYNLYCKITGGQRIDMFGARKQDLLDIWT
ELIEAGLESGHAYAKSLRTVKSCVGSSWCRFGIGDSVGMAIRIEERYKSIRAPHKIKGGV
SGCVRECAEAQNKDFGLIATEKGFNIFVGGNGGAKPRHSELLAIDVPVDEVIPILDRYLI
FYIRTADKLQRTARWIESLPGGIKYLRQVILEDKLGICAALEKQMEELVSTFFCEWTEAV
KSPERRKQFQQFANTEENVVDTIEPMVERGQTRPSNWVDESVTKDFKGTKWSALSWQPIV
EASKFRDIPTGDSNAVKRGDAQLAIFKVRGKYYCTQQMCPHKRAFVLSDGLIGEEISAEK
QKLWVSCPYHKRNFELTGDDAGKCGNDESVNIATFPVEERDDGWVYVKLPPVEELDAVLG
TEKWRIKQGDDVKAKELKVKGKKGVLVNGKGREVVIERGVGENGANGIDW
NT seq 3213 nt   +upstreamnt  +downstreamnt
atgacagccgaaataccatccgtatctaatgatggaggtagtaagaggaaaagagttgtt
gttgtgggactagggatggttggaattactttcgttgaaaaattgatgaaaatggatgtg
aaaagaagagaatacgacgttattgttattggcgaggaaccacatctagcctacaacaga
gtcggccttaccagcttctttgaacaccgagatgtcgaaaggttatatatgcagactgaa
gcttggtataaggcatttccagaaggttcactgagctatcatctcaattccctggttact
gagatcgattccgagaagaagttcgtgattactgcaaaaggtgacacaatcgaatgtgac
attctggtcctggccacaggatccaatgcaatccttccaaagtcaattgttggctacgat
gcaactggcgtatttgtgtatcggaccatcgaggatttgcagaaactcattgcattttct
gctacgaagaagggtaagactggtattgtggtgggaggaggacttctgggtctcgaggct
gcgaaagcaatgatggatcttgaggagttcgggaaaatcaaagtcatcgagtccttccca
tacgttttgggtagacaggttgatcccgagggtggcgccatggtcgttgagcaagtgaga
gatctgggagtagatcttatcctcggcaagatggtcaacaagtttcttacggatgagaac
aatggcgtaactggtgtggagttcgaggatggccacaaagtagacggtgcctgtgtctgc
gttgcaattggagtttctcctcgtgatgagctagctcgaaagtctggtttggagtgcggc
cctcgcggtggcatcattgtcggcgatgacttgcaaacttcagtgaaggatatttacgcc
atcggcgaatgtgcaaattgggcgaacatgtgctatggcctttacgcacctggtatcgag
atggccgagatccttgcgtttaatctgacggacgcaaagttgcgctccccgagatctctc
acaactccggatatgagcaccaaactcaagcttttagggattggagtcgccagctttgga
gatgctttcgctgaccagttcggacctcagtggctgcctggtaagcggcaggataaggag
attgagaagactcttgtgaaagtcttgacctacaaagatccattcaaccacgtctacaag
aaatatctgtttacaaaagatggaaagtatctgcttggtggcatgatggttggagatacg
aatgactacgttaagttacttccaatgtcgaagcaacacaaacagctggagatggcaccg
ggagagctgataattggaaagccgggaggagaagatgatgctaatgatttaccggacgaa
gcacagatctgctcatgtaacaatgtgaccagaggggatattaccaagacaatcaaggat
ggcacttgtaagaccgtcaacgagatcaagatatgtaccaaagctggtacaggatgtgga
ggatgcattccactggtgacctccatcttcaataaaaccatgatcgatatgggccaagaa
gttaaaaaccacctctgctctcacttcgcctactcccgcgcagaactcttccacgtcgtc
atggtcaagaagctcgattcgttcgaagccattatgaaggaaagcggagtgcctggttca
ttagggtgcgaactgtgcaagccagcagttgcatcgattctcgcttccctgtacaacaag
cccatcgctgatcctggacgaagagggcttcaagacaccaacgataagttcctagccaac
atccagcgcaatggtactttctcagtcatcccacgtgttgccggtggtgagatcaccccc
aagaaacttgctgctattgccagtgtggctcagaagtacaacttgtattgcaagatcact
ggaggtcagcgaattgatatgttcggtgccagaaagcaagacctgctcgatatctggacc
gaactcatcgaagcaggcctcgaaagtggccacgcatacgccaagtctcttcgaactgtc
aagagttgtgtcgggtcttcttggtgccgtttcggtattggcgacagcgttggaatggca
atccgcatcgaagaacgatacaaaagtattcgggcgccgcataagatcaagggtggagtc
tctggttgtgttcgagaatgcgcagaggctcagaacaaagatttcggcctgattgctact
gagaagggcttcaacatctttgttggcggcaacgggggagcaaagccgagacattcagag
ctcttggccatcgatgtcccagtggatgaggttattccaattctagatagatacctcatc
ttctatattcgcacagcagacaagctccagaggactgcgcgatggattgagagtcttcca
ggaggtatcaagtatttacgccaagtcattctcgaggacaagctgggcatttgcgcagct
cttgagaagcagatggaggagctcgtgtccactttcttttgcgagtggactgaagcagtg
aaaagtccggaacgacgaaagcaatttcagcaatttgccaacactgaggaaaatgtcgtt
gacacaatagaaccgatggttgaacgcggtcagacacgtccttccaactgggttgacgaa
tcagtcacgaaagacttcaagggtacgaaatggagtgcattgtcctggcagcccatcgtt
gaggcttccaaattcagagacatccctactggggacagcaatgccgtcaaacgaggagac
gcacagctcgccattttcaaggttcgtggaaagtattactgcacccaacagatgtgtccg
cacaagagagctttcgtcctgtccgatggactcattggcgaggaaatttcagccgagaag
caaaagttatgggtttcgtgtccgtaccacaaacggaatttcgaattgacaggagatgat
gctgggaagtgcggcaatgatgaatcagtcaacatcgctactttcccggtcgaagaacga
gatgatggctgggtttatgtcaagcttcctcctgttgaggaacttgatgctgtgcttggg
acggagaagtggaggatcaagcagggagatgatgtgaaggctaaggagttgaaagtaaaa
gggaagaagggagttctagttaatggaaaggggcgtgaggtggtgattgagaggggtgtt
ggtgagaacggcgcgaatggtattgattggtag

DBGET integrated database retrieval system