KEGG   Phialocephala scopiformis: LY89DRAFT_596444Help
Entry
LY89DRAFT_596444  CDS       T04865                                 

Definition
(RefSeq) amidase
  KO
K01426  amidase [EC:3.5.1.4]
Organism
psco  Phialocephala scopiformis
Pathway
psco00330  Arginine and proline metabolism
psco00360  Phenylalanine metabolism
psco00380  Tryptophan metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LY89DRAFT_596444
   00360 Phenylalanine metabolism
    LY89DRAFT_596444
   00380 Tryptophan metabolism
    LY89DRAFT_596444
Enzymes [BR:psco01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.4  amidase
     LY89DRAFT_596444
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 28819649
NCBI-ProteinID: XP_018064736
JGI: 596444
UniProt: A0A132BDD4
Position
Unknown
AA seq 569 aa AA seqDB search
MTYDSFLPGNQSWKEIASEKRCRNMVKTPKDWILPESVIKKSQATRSIAGQFIEDLLDEE
TLSITKLDVPEIVERTSNGSLTAVKVVTAYSKRAAYAHQLSNILLEIAFDIALERAKEID
EYFEKNQKPIGPLHGVPLTLKDQFHIKGLETSMAFVGWIGTFEGKKGTGKEKNTESELIR
ELYSLGAIPIGKISAPETNNNILGYAWNPHNQLLSTGGSSGGEGAMQALRGSAFGIGTDL
GGSVSMPASFNGVFSLKPSFRRISFKDVANTGTGQMIMPTVAGIMGHSVLTLRLVFKALL
STEPWLYDPYVLQVPFRDYFVEETSNLSFGFVKDDAVVTPHPPISRALDIVEKAMLAAGH
ETIPWEPPSVNESIAIRGPIARGDGCPDVYEAIKLSGEPIVPEIRHLFPDGNLQPPMNLV
DYEKVVVHMKSYRQRYHDYWSSTASKTSSGRPVEAIILPVSPYAAVLPGKFFHSPYTSFI
NVLDYTTIVIPITFADKKIDVVPADFMPLTDTDRLNMEAYDSEIYDGAPASIQIVARKME
EEKLLAMAQVVVDALEKYWQSEEGKRHPG
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atgacttacgacagtttcctcccaggaaatcaatcatggaaagaaattgcctccgaaaag
agatgtcgaaatatggtcaagacaccgaaggattggatcttgcctgaatcggtgattaag
aaaagccaagcaacacggagcatcgctgggcaattcattgaggatcttttggatgaagag
acactatccatcaccaaactcgatgtcccggaaattgtggagcgtacaagtaatggttcc
cttaccgcggtgaaagtcgttacagcgtactcaaagcgagctgcatatgcacaccaactg
tcaaacatccttctcgaaatcgccttcgatattgcacttgaaagagccaaggagattgac
gaatatttcgagaagaatcaaaaacccattggtcctctgcatggagtccctctcacactc
aaagaccagttccacatcaaaggtcttgaaacttccatggcatttgttggctggataggt
actttcgagggaaagaaaggtactggaaaagagaagaatacagaaagcgaattgattaga
gagctctacagccttggcgcgattcccatcggaaagataagtgctcctgagacgaacaac
aatatacttggctacgcatggaatccgcataatcaacttctctcaaccggcggctcctcc
ggtggggaaggagcaatgcaggctttgagaggaagcgcatttggaatcggaactgactta
gggggttctgtttccatgcctgcctcgttcaatggtgtcttcagtctcaagccttcattt
aggcgtatctcattcaaggacgtggcgaacacaggtactggccaaatgatcatgcctacc
gttgctggcatcatgggccactccgttttaacgcttcgcctagtgttcaaagcactactc
tccactgagccatggctttacgatccatatgttcttcaagttccattcagagactacttt
gtggaagagacaagcaatctttctttcggtttcgtaaaagatgatgccgttgtgaccccg
catcctcccatttcccgcgcacttgacatcgtggagaaagctatgctagcagccggacac
gagacaattccatgggaacctccctcagtcaacgagtcgattgctatccgtggtcctatt
gctcgaggtgacggatgtcccgatgtctacgaggctatcaagctttctggggaacctatc
gttccggagattcgacatttgtttcccgatggaaatctacagccaccgatgaaccttgta
gactacgagaaagtagtcgtgcatatgaaaagctatcgccagagatatcatgactactgg
agctctacggctagcaagaccagcagtggtcgtcccgtggaagcaattattcttcccgtc
tctccttacgctgccgtattgccgggcaaattcttccactcgccatacacaagttttatt
aacgtactagattatacaacaattgtcattccaatcacgttcgccgacaagaaaatcgat
gtcgtgcctgctgatttcatgccgctcaccgatacagatcgattgaacatggaagcgtat
gattctgagatatacgacggagctccagcttccatacaaattgtcgcgaggaaaatggag
gaggagaagcttctcgcaatggcacaagtcgttgtcgatgcgctggagaaatactggcag
agtgaagaaggaaaacggcatccaggttga

DBGET integrated database retrieval system