KEGG   Phialocephala scopiformis: LY89DRAFT_602830Help
Entry
LY89DRAFT_602830  CDS       T04865                                 

Definition
(RefSeq) glycoside hydrolase
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
psco  Phialocephala scopiformis
Pathway
psco00460  Cyanoamino acid metabolism
psco00500  Starch and sucrose metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LY89DRAFT_602830
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    LY89DRAFT_602830
Enzymes [BR:psco01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     LY89DRAFT_602830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-GeneID: 28819995
NCBI-ProteinID: XP_018061069
JGI: 602830
UniProt: A0A132B472
Position
Unknown
AA seq 729 aa AA seqDB search
MRVSLLPLLASATPIFAAAGDGDWATAYSKAKTALAKLSTANKVTMVTGMGWEKGPCVGN
IAAIAAIGFPELCLQDGPLGVRYAQQVTVFPAGIMAGSTWDTSLMYARGYALGSESKALG
VHVQLGPVGGPLGKIPEGGRNWEGFSNDPYLSGVGMANTINGMQAAGVQACAKHYIGNEQ
ELNRNTQSANFDDRSIHELYLWPFAEAVKANVSSVMCSYNKIHSTWSCESETMLDLLKEE
LDFQGYIVSDWGAQHTTAGSANAGMDMAMPGDNFGDNKFLWGSALTSAVSSNQVSASRLD
DMVTRILASWYLVGQDSGYPTVKGWSSWNGGKGGPNVQGDHKTVARAIARDGIVLLKNEG
GALPLNKPASLAVVGYDAVTNPQGANGCVDRKCDNGTLAMGWGSGTAEFPYLIAPLDAIK
AQVTKDGTTLTTSTSDTPSAGAAAASSAATAIVFLNSDSGEGYITVEGNAGDRNNLDPWH
HGNDLVAAVAAVNKKTIVVVHSVGPLILESILASPNVVAVVWAGIPGQESGNGLVDILYG
STSPSGKLPYTIAKATADYGTAVSASDDPYTEGLFIDYRHFDQKAIAPRYEFGFGLSYTT
FSYSNLTISALSTAAGSTAMAPGGQVGLYDIVATVSVTITNNGTVAGAEVPQLYIGLPSS
APSTPAKQLRGFDKLSLAAGASGTSTFKLRRKDLSYWDTTSKSWKVPTGAFSVMVGASSR
DIRVTGTLQ
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgagggtttctttacttcccctactggcatccgccacgccaatctttgcagcagcagga
gatggagactgggcgacggcgtattcgaaagccaagacggcattggcaaagttgtcgact
gccaataaggtaacgatggtgacggggatgggatgggagaagggaccatgtgtggggaat
attgctgctattgctgccattgggttcccagagctgtgcttgcaagatggacctctgggg
gtgaggtacgcacaacaggttactgtttttccagctggcataatggcaggatcaacatgg
gatacatctctgatgtatgcccgaggttatgctcttggttctgaatcaaaagcactcggt
gtccacgtacagttgggtccagtcggtggacctcttggaaagatccctgagggaggacga
aactgggaaggattctccaatgacccatatctctcaggtgttggtatggcaaatactatc
aatggcatgcaagcagcaggtgttcaagcatgtgcaaagcactacatcggcaacgagcaa
gaactcaatcgtaatactcagagtgctaactttgacgatcgatcaattcatgagctctac
ctctggccgtttgctgaagccgtcaaggccaatgtctcttccgttatgtgctcatataat
aaaatccacagtacatggtcatgtgagagtgagacgatgcttgatctattgaaagaagag
ttggactttcaggggtatatagtgagcgattggggtgctcaacacacgacagctggaagt
gccaatgctggcatggacatggctatgccaggtgacaattttggtgataacaagttcctt
tggggctctgctcttacatctgcggtctcatcgaatcaagtctccgcctctcgtctcgac
gacatggtgacccgcatcctcgcctcctggtatctagtcggtcaagacagtggctatccc
acagtcaaaggctggtcatcctggaatggaggcaagggtggtcccaatgtccagggcgat
cacaagaccgtcgctcgagcaattgctagagatgggattgtgttgttgaagaatgaggga
ggggctttgcctttgaacaaaccggccagtttggcggtggtgggttacgatgctgtaacg
aatccgcaaggtgcgaatgggtgtgttgaccggaagtgtgataatggaactttggccatg
ggttggggctctggaaccgccgaattcccttatcttatcgcgcccctcgatgccatcaaa
gctcaagttacaaaagacggtaccactcttacgacatccacttctgatactcctagtgct
ggtgcggctgccgcttcttcagctgcgacagcaattgtatttctcaactccgattctggt
gaagggtatatcacagttgaaggaaatgctggtgacaggaacaatcttgatccatggcat
catgggaatgatcttgttgctgcagtcgcggcggtgaataagaaaacgattgttgtagtt
cattcagttggacctttgatcttggagagtattttggcaagtccaaatgtggttgcagtc
gtctgggctggaattccaggacaagaatccggcaatggactcgtcgacatcctctacggg
tctacatcaccaagcggcaagttgccgtacacaatcgccaaagcaacggcagactacggt
actgccgtaagcgcaagcgatgatccatataccgagggacttttcatcgattaccgacat
ttcgatcagaaagccatagcccctcgctacgagttcggctttggactctcatacaccacc
ttttcgtactcaaatctcacgatctcggctttgagcaccgcggctggcagcacagctatg
gctcctggtggccaagttggactttatgatatcgtggctactgtttctgtcacgattacg
aacaacgggactgtggcaggagccgaagtcccgcaattgtacatcgggcttccatcttca
gcaccgagtacaccggccaagcagctgagagggttcgacaaattgagtcttgcagctgga
gcgagtgggacgagtactttcaagttgagaaggaaagatttgtcttattgggatacgaca
agtaagagctggaaagtgccaacaggagctttcagtgtcatggttggtgctagctctaga
gatattagggtgacgggcacactgcagtga

DBGET integrated database retrieval system