KEGG   Phialocephala scopiformis: LY89DRAFT_629746Help
Entry
LY89DRAFT_629746  CDS       T04865                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
psco  Phialocephala scopiformis
Pathway
psco00260  Glycine, serine and threonine metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LY89DRAFT_629746
Enzymes [BR:psco01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     LY89DRAFT_629746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-GeneID: 28820945
NCBI-ProteinID: XP_018062912
JGI: 629746
UniProt: A0A132BA62
Position
Unknown
AA seq 410 aa AA seqDB search
MTSENLHQAQNGINGHKDLEGLGGTTDLPPADGPHKQQNAWSTPGPAAFDFRSDVVTTPT
PSMLAAVQNTTLLDDVFMEDPTTTSLESHLATLTSHEAALFVLSGTMGNQLALRSHLTQP
PHSVLCDYRAHISEWEAGGVATLSGALVRCVVPSNGVYLTLEDIKKHVVLGDEIHSCPTK
VISLENTLGGTIMPLEEVRRIAAFAREHEIKMHLDGARIWEAVVAGAGSLPDYTKEFDSV
SLCFSKGLGAPVGSILVGNAKFIKHARWVRKSIGGGLRQPGVVTAAARVAVDETFGKGPN
GEGGLLKQSHITARRIAKIWTDMGGKLDQPTETNMVWFNLDDVGLSEDEFVELGKKHGLR
LLGGRLVVHYQISDEAVIRLEKVMKEVIEKKKTSGGGAVEKKGGEKAYGT
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagagaatctacaccaagcacagaatggcatcaatggccacaaagatcttgaa
ggtcttggcggaacaacagacctacctcccgcagacggacctcacaagcagcaaaacgcc
tggtcaaccccaggaccagctgcttttgatttcaggagcgacgtagtaacaacaccaacc
ccctcaatgctcgccgcagtacaaaacactactctcctcgacgacgtattcatggaagac
ccaaccaccacctccctcgagtcccacctcgcaactctcacctcgcacgaagcagctctc
ttcgtcctgtccggcacaatgggcaaccaactcgcgctccgctcgcacctcacccagcct
ccgcactccgtgctctgcgactaccgcgctcacatctcggagtgggaagctgggggcgtg
gctacgctctccggtgcgctggttagatgcgtggtacctagcaacggggtttatttgaca
ttggaggatatcaagaaacacgttgttctaggagacgagatacatagttgtcccactaag
gtcatttcattggagaacacgttgggtgggacgatcatgccattggaagaagtgcgacgc
atagcagcatttgcgcgagagcacgagattaagatgcatctcgacggagcccggatctgg
gaagctgtcgttgcaggtgcagggtcattacctgactacactaaagaattcgatagtgtc
agtttatgtttctcgaaaggattaggtgcgcctgtgggaagtattctagtcgggaatgcg
aagtttattaagcatgctaggtgggtgaggaagagtatcggtggtggtctacgacagcct
ggtgtggtcacagccgcggctcgagtcgctgtagacgagacgttcggaaagggaccgaat
ggtgagggtggtcttttaaagcaaagtcatattacagcgaggaggatcgcgaagatatgg
acagatatgggcgggaagctggatcaaccaactgagacgaatatggtgtggtttaatctt
gacgatgttggactttcagaggatgagttcgtggagttgggtaagaagcatggattgagg
ctgctaggtggacgtttggtggtgcattaccagattagcgatgaggcggtgattaggttg
gaaaaagtgatgaaggaggtaattgagaagaagaagacgagtggaggtggtgctgttgag
aagaaaggtggcgagaaagcctatgggacgtga

DBGET integrated database retrieval system