KEGG   Phialocephala scopiformis: LY89DRAFT_681617
Entry
LY89DRAFT_681617  CDS       T04865                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
psco  Phialocephala scopiformis
Pathway
psco00100  Steroid biosynthesis
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
Module
psco_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    LY89DRAFT_681617
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     LY89DRAFT_681617
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 28824061
NCBI-ProteinID: XP_018075338
JGI: 681617
UniProt: A0A194XLC8
Position
Unknown
AA seq 332 aa
MISYALATFVYIRSFSVKPGNTEQRELAAGGHSGNMIYDWYIGRELNPRITLPFFGEIDI
KVFCELRPGMMGWMILNFTFIAHQFRTYGVITDSILLITAFQTLYILDSYWMESAMLTTM
DITTDGFGFMLAFGDLVWVPFIYSIQARYLAVYPLSLGYAGCAGVLVPLAVGYYIFRSAN
NEKNRFRNNPNDARVAHLKYIETKSGSRLLTSGWWGTVRHVNYTGDWVQSWAYCLPTGLA
GYLINHSSVAPVVGQSAADSSFVYQSSGVHSEVVQGAAKGWGMIFTYFYVIYFAVLLIHR
ESRDEAKCERKYGADWKRYCEKVKYRVIPGIY
NT seq 999 nt   +upstreamnt  +downstreamnt
atgatttcctacgcactcgcaaccttcgtctatattcgcagcttcagcgttaagcctggc
aataccgagcaacgcgagctagcagcaggaggacattcaggaaatatgatatacgactgg
tatatcggccgtgaactgaacccacgcatcacccttcctttctttggcgagattgatatc
aaagtgttctgcgaattgcgtccagggatgatgggttggatgattctgaatttcacattc
atcgcccaccaattcaggacatatggagtgatcacagacagtatcctactcattactgct
tttcagactctgtacattctcgactcttactggatggaatctgccatgctcaccacgatg
gatatcaccaccgacggattcggattcatgcttgcatttggtgacctcgtctgggttccc
ttcatttactccatccaggcccgttacttagcagtgtaccccctctccctaggctacgct
ggctgcgcaggcgttctcgttcctctcgcagtggggtactacatattccggagcgcgaac
aacgagaagaaccgcttccgcaacaaccccaatgatgcccgagtcgctcatctgaaatac
atcgaaaccaaatctggctctagactcttaacatctggatggtggggaactgttcgtcac
gtcaactacaccggagattgggtccaatcctgggcttattgtcttccaaccggcttagca
ggctatctcatcaaccatagctctgtcgctcccgtagttgggcaatcggctgctgatagc
tcctttgtttatcagagttcaggagtacattcagaggttgtacagggagctgcaaaggga
tggggaatgattttcacgtatttctacgtgatttactttgcagtcttgctcattcaccgc
gagtcgagagatgaggcgaagtgtgagagaaagtatggagctgattggaagagatattgc
gagaaggtgaagtatagggttattcctgggatttactga

DBGET integrated database retrieval system