KEGG   Phialocephala scopiformis: LY89DRAFT_684758Help
Entry
LY89DRAFT_684758  CDS       T04865                                 

Definition
(RefSeq) hypothetical protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
psco  Phialocephala scopiformis
Pathway
psco00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:psco00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LY89DRAFT_684758
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psco01007]
    LY89DRAFT_684758
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psco03016]
    LY89DRAFT_684758
Enzymes [BR:psco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     LY89DRAFT_684758
Amino acid related enzymes [BR:psco01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   LY89DRAFT_684758
Transfer RNA biogenesis [BR:psco03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    LY89DRAFT_684758
 Prokaryotic Type
    LY89DRAFT_684758
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g DALR_2 tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 28824667
NCBI-ProteinID: XP_018072187
JGI: 684758
UniProt: A0A194XDK3
Position
Unknown
AA seq 795 aa AA seqDB search
MAQLKVHNSLTPGGTVPFLPLEEGKVSWYACGPTVYDHSHLGHARNYVSTDIIRRIMRDY
FGYQVKFVMNITDVDDKIILKARRAKLLELEKSKTYTEPELAKLAATAFQSYAEGNLPEL
LKDGSKLSPRNYAERRDAAYGKVLAGGTLNGEGKPGDAEAKMKMHLSNLTAASQAIQENK
VFGGADEVLLPYLDSLYKDSIDGKDHTIFTKVTQYWEAQFMDDMDNLNVMRPDYITRVTT
YVPQIVTFVDMIVEKGFAYEADGSVYFDIAAFEKAGNPYARLCPNSRNDKALQEEGEGSL
SKNLGGKRGPCDFALWKKSKAGEPVWPSPWGEGRPGWHIECSVMASDILGSQMDIHSGGI
DLAFPHHDNELAQSEAYYCSHGQVHNWVKYFFHMGHLSISGSKMSKSLKNFQTIKDALKN
DYTPRAMRIVFLMGRWNDGVEISPDMRKQAEGWETTINNFFTNTKSLIMQSKSAEEGLKT
LSINGKSGGLHETLEKAQSEMQSALTDSFDTPRAMRILAEIVRDANKHDSEPGSATDITG
LKSIARWITKMVGIFGLDANASPPYEGLGWTNTASNAHLSTKEIVEPYVKVYQSVNSEVE
RLALHSDSLDALMAEDVDTKFSGLEASGTKDSEALAMPYLIAVSKIRDELRRIAPNSESK
KQILTLSDRIRDNDLTDLGVYLDDRSVDQGALIKFVPKAELLAQREEKAAKEREKTAQKE
KARLERERIELEKAEKAKLSPMDMFKDDRFSAWDDKGLPTKTKEGEDVPKSALKKLGKEW
ERQNKLHQEWKAKSG
NT seq 2388 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaattgaaagtccacaattcattaactcccggcggcacggtgcctttcttgccc
ttggaagaagggaaagtttcgtggtatgcttgcggacctacggtgtatgaccattcacac
ttggggcatgctaggaattatgtctctacagatatcattcggagaatcatgcgcgattac
tttggctaccaggtcaaatttgttatgaacattacagacgtcgatgacaagattatcttg
aaggcaaggagagcaaagcttctagagctcgagaagtcgaagacctacaccgaaccagaa
ctagcgaagctggctgcaacggcattccaatcctacgcggaaggaaatctaccagaactg
ctgaaagatgggtcgaagctgagtcccagaaattatgcagagaggagagatgctgcatat
ggaaaagtgcttgctggtggaacgttgaatggggaggggaagccaggagacgccgaagcc
aagatgaagatgcatttgagcaacttgactgctgcttctcaagcaatacaagagaataag
gtctttggcggggctgacgaagttctgttaccgtacctggactccctctacaaggattca
attgatgggaaggaccatacaatcttcaccaaggtgacacaatattgggaagctcaattt
atggatgacatggacaatctcaatgtcatgagaccggattacattactcgagttacaacc
tatgtcccgcagattgtgacgttcgttgacatgattgtggagaaggggtttgcctatgaa
gcagatggttctgtctatttcgacattgctgcatttgagaaggctggaaacccatatgca
cgactctgccccaacagccgaaatgacaaagcattgcaagaagagggtgagggctcgttg
tcgaaaaaccttggaggaaagcgaggaccttgtgattttgctttatggaagaagtccaag
gcaggagaaccagtctggccaagcccttggggtgaaggacgtccgggatggcatattgag
tgctctgtgatggcttcagatattcttggttcgcagatggatattcattctggaggtatc
gatctcgcttttcctcatcacgataacgagttggctcagagtgaagcatattactgctcg
catggtcaagttcacaactgggtcaaatactttttccatatgggccacttgtcaatttcg
ggctcaaagatgtcgaaatcgttgaagaacttccagaccatcaaggacgcgttgaagaat
gattacactccaagggctatgcgaattgtctttttgatgggtcgatggaatgatggtgtg
gagatctcccctgatatgcgaaagcaagctgagggatgggagactacgatcaataacttc
ttcaccaacacgaaatcgttgatcatgcaaagtaagagtgcagaagagggactcaagaca
ctctccatcaacggcaaatctggagggcttcatgaaactctggagaaggcacagtcagaa
atgcagagcgctttgacagattctttcgatacaccacgagctatgcgcattcttgctgag
atcgtcagggatgcaaacaaacacgacagcgaacccggctctgcaaccgacattacagga
ctcaagtccattgctcgatggatcacaaagatggttgggatctttggattggacgcaaac
gcttccccgccttacgaaggtcttggttggacaaataccgcttcgaatgcacacttgagt
accaaagaaattgttgagccatacgtcaaagtatatcaaagtgtcaattcggaagtcgag
cgtcttgcgctgcattcagattcacttgatgctctgatggctgaggatgtcgatacgaag
ttttcaggtctggaagctagtggcacgaaggattccgaggcgttggccatgccttacttg
atagctgtctcaaagattcgagatgagttgaggaggattgcaccaaactcagaatcgaag
aagcagattcttacgttgtctgaccgaatcagagacaatgatcttaccgatttaggtgtg
tatttggatgacagatctgttgatcaaggtgcgctcatcaagttcgttcccaaggcggaa
cttctggctcaaagggaggagaaagctgcgaaggagcgggagaagactgcccagaaggaa
aaggctcgattggagcgtgagagaattgagctcgagaaagctgaaaaggctaaactcagt
cctatggatatgttcaaggatgataggtttagtgcttgggatgacaagggtttgcccaca
aagaccaaggagggtgaagatgtgccaaaaagcgctttgaagaaattgggcaaggaatgg
gaaaggcaaaataagctacatcaggaatggaaggcgaaatctggttga

DBGET integrated database retrieval system