KEGG   Phialocephala scopiformis: LY89DRAFT_689759Help
Entry
LY89DRAFT_689759  CDS       T04865                                 

Definition
(RefSeq) putative mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
psco  Phialocephala scopiformis
Pathway
psco00051  Fructose and mannose metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    LY89DRAFT_689759
Enzymes [BR:psco01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     LY89DRAFT_689759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh UDPG_MGDP_dh_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-GeneID: 28825691
NCBI-ProteinID: XP_018064917
JGI: 689759
UniProt: A0A132BDR4
Position
Unknown
AA seq 388 aa AA seqDB search
MKAVHFGAGNIGRGFVAEFLHNSGYEVVFCDVMDSVIDQLNASKSYKVIQVGAEGTSETT
ITNYRAINSKHNEAQVIDEITTADIVTCSVGPNILKFIAPVIAKGVDARPNDATPIAVIA
CENAIGATDTLAEHIKHPKHTPEHRLDDHHERARYANSAIDRIVPAQDPNAGLDVKLEKF
YEWVVDRSPFHDHEPPAIKGVKWVDDLIPYIERKLFTVNTGHAAAAYHGYYHKKTTVYDA
LQEPMIVDEVRKALAETSTLIVGKHGIETEEQKAYVEKIIKRIGNPHLEDAVERVGRAPL
RKLSRKERFIGPAAELAEEGKPFDALLDAAEMAFRFQNVEGDEESAELAKIMAGTSPEQV
VEKVCGLTSSDKLFPHVVEVVKRVQADA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgtacatttcggtgccggtaatattggcagaggattcgttgctgaattcctc
cacaactcaggatatgaggtcgtcttctgcgatgtcatggacagcgtgattgaccaactc
aacgcctcaaagtcatataaagtcatccaagtcggagcagaaggaaccagcgaaaccacg
atcaccaactaccgagccatcaactcgaaacataacgaagcacaagtgatcgacgagatc
acaacggctgacatcgtaacctgctccgttggccccaacatcctcaaattcattgctcca
gttatcgccaaaggagtcgatgctcgaccaaacgatgccacaccgatagctgtcattgcc
tgcgaaaatgcaatcggcgcaaccgacactctcgcagagcacatcaaacaccccaaacac
actcccgaacaccgccttgacgaccaccacgagcgagcacggtatgcgaattcagccatt
gatcgtatcgtgccagcacaagaccccaatgcaggcttggatgtcaagctcgagaagttc
tacgagtgggttgtcgatcgatcaccattccacgaccacgaaccaccagcgatcaaggga
gtgaagtgggttgacgatctgatcccatacatcgagcgaaaactgttcactgtcaatacc
ggccatgctgcagccgcataccacggatactaccacaagaagaccaccgtctacgacgct
ctacaagagccaatgatcgtcgatgaggtccggaaggcactcgccgagaccagcaccttg
atcgtcgggaagcatggcatcgagacagaagaacaaaaggcatacgtggagaagatcatc
aagcgcattggcaaccctcatctcgaggatgctgtcgaacgtgttggtcgtgcgccattg
agaaagctgagtcgcaaggaacgcttcattggccccgctgccgaactcgctgaggagggc
aaacccttcgatgcgttacttgacgctgcagagatggcattccgattccagaatgtggag
ggagacgaggagagtgcggaattggcaaagatcatggctggcacttcgccagaacaggtc
gtagaaaaggtttgtgggttgacttcatcagacaaactcttccctcacgtcgttgaggtt
gtgaagagagtgcaggccgatgcatag

DBGET integrated database retrieval system