KEGG   Phialocephala scopiformis: LY89DRAFT_706556Help
Entry
LY89DRAFT_706556  CDS       T04865                                 

Definition
(RefSeq) transketolase
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
psco  Phialocephala scopiformis
Pathway
psco00680  Methane metabolism
psco01100  Metabolic pathways
psco01200  Carbon metabolism
Module
psco_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    LY89DRAFT_706556
Enzymes [BR:psco01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     LY89DRAFT_706556
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C E1_dh DXP_synthase_N Toxin_ToxA
Motif
Other DBs
NCBI-GeneID: 28827261
NCBI-ProteinID: XP_018072216
JGI: 706556
UniProt: A0A194XCH9
Position
Unknown
AA seq 721 aa AA seqDB search
MTICAIEFVLKRCTELNDRVLKTFRCLIADLCEQFRGGHPGSAMGMAAIGIALWKYMMKY
SPTNPDFFNRDRFVLSNGHTCLFQYTFLHLVGYEHMTFEQLKTYHSSRTDSFCPGHPEIE
HPGIELTTGPLGQGVANAVGLAMATKHLAATYNRPEYPVVNNITWCMIGDACLQEGVALE
AISLAGHWKLNNLVMIYDNNQITCDGSVDLCNNEDINAKMLACGWNVINVPNGNHDIEGI
VRALVSARNSKDKPTLVNIRTVIGIGSKSAGDAKAHGAAFGAEDVASIKRKFGMDETKHF
QVSDEVYDFFREAKPRGRQLEAEWNNLVDSYAQTYPELHKEFSLRVAGKCTDDWTKFIPA
KSDLPTSPIASRKSSGLVCNPLAQNIKNFMVGTADLSPSVNMIWKGKIDFQHPDRRTSCG
IHGDYSGRYIHWGVREHAMASISNGLAAFNKGTIIPVTSSFFMFYTYAAPGIRMGALQRL
QQIHIATHDSIGTGEDGPTHQPIELAALYRAMPNLLYIRPADGEETAGAYIAAMKATDTP
SMISLSRQDLEQYPQHSSRDGVQQGAYVLMEKANADVTLIGVGAEMVFAVKTAQLLEDKF
GLKARVVSFPCQRLFDQQPIEYKREVLQYRSNAPRVVVEAYAAQGWERYADAGYSMHSFG
HSLPGKDAYRYFRFDENLIAPKVAELVKGVRSNGIESLRAAGHTLSHSICDLEDQSKTVF
Q
NT seq 2166 nt NT seq  +upstreamnt  +downstreamnt
atgactatttgcgcaattgaatttgtcttgaagcggtgtaccgagttgaatgatcgcgtt
ttgaagactttcagatgtctcattgcggatctttgcgaacaattcaggggtggacaccca
ggaagtgccatgggtatggcagctatcggcattgctttatggaagtacatgatgaagtac
tcaccaacaaatcctgacttttttaaccgagaccggtttgtgctctcaaatggccacact
tgtctcttccagtacacatttctccaccttgttggatatgaacatatgactttcgaacaa
ctaaaaacctaccactcctcgcgaacagactctttctgccccgggcatcccgaaatcgaa
catcctgggattgagttgactacggggcctttaggtcaaggtgttgcgaatgccgttggg
ctggctatggctacaaagcacttggcagctacatacaataggccggaatatccagtcgtg
aacaacatcacctggtgtatgattggagatgcgtgtctacaggagggtgttgctctcgag
gccatttcacttgctgggcattggaaactcaataacctggtcatgatctacgacaataac
caaatcacttgcgacggatccgttgatctatgcaacaatgaagacatcaacgcgaaaatg
ttggcttgcggatggaatgtaataaatgtcccgaacggcaatcatgacatcgagggcatc
gtccgagcacttgtttccgcaaggaatagcaaagacaagccaactttggtcaatatccgg
accgtaattggaatcggaagcaagtctgcaggcgatgctaaagcacacggagccgcgttt
ggtgctgaagatgttgccagcatcaagcgaaagttcggtatggatgagacaaagcacttc
caagtgtccgacgaggtctacgactttttccgggaagccaaacctcgaggcaggcaactt
gaggccgaatggaacaatttggtggattcatatgcacaaacttacccagaacttcacaaa
gaattttctctgcgagtagctggaaagtgtacagatgattggacgaaattcatccctgcc
aagagtgatcttcctacaagcccaatagcctcaagaaaatcatcaggattggtctgtaat
cctctggcccagaacatcaagaatttcatggtgggcacagccgatctctcaccttccgtg
aacatgatctggaaaggcaagatcgacttccagcacccagaccggcgcacttcttgtggg
atccatggcgattactccggacggtacatccattggggcgtccgggaacatgcaatggca
tcaatatctaacggtttggcagctttcaacaaaggcaccattatcccggtcacatcatca
ttcttcatgttttacacatacgccgcgccaggtatccgaatgggcgccttgcaacgtctg
cagcagatccacattgcaacccatgactcgattggcaccggcgaagatggccccacacat
caacctatcgaactggcagctctatatcgtgctatgccaaacctcttatatatccgaccc
gccgacggcgaagagacagctggtgcatacattgctgcaatgaaggctactgatacaccg
agcatgatctccttgtcgagacaagatttggaacaatatccgcaacactcgtctcgtgat
ggcgtacaacagggcgcgtatgtcctcatggagaaggccaacgcagatgtgacccttatt
ggcgttggggctgaaatggtctttgctgtcaagactgcccagcttcttgaagataaattt
ggattgaaggctcgcgttgtcagcttcccatgccaaagactgtttgaccaacagccgatt
gagtacaaacgtgaagtgttgcaatataggagcaatgcgcctcgagtagtggttgaggca
tatgctgctcaaggatgggagaggtacgccgatgcaggatactcgatgcattcatttgga
cactccttaccaggaaaggatgcataccgatactttagatttgacgagaatttgattgcg
ccaaaagtggctgaattggtgaagggggtgagatccaacggaatcgagagcttgagagct
gctggacacacgctttcgcacagcatctgtgatctcgaggatcaatcgaagacggttttc
cagtga

DBGET integrated database retrieval system