KEGG   Phialocephala scopiformis: LY89DRAFT_722376Help
Entry
LY89DRAFT_722376  CDS       T04865                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
psco  Phialocephala scopiformis
Pathway
psco00450  Selenocompound metabolism
psco00970  Aminoacyl-tRNA biosynthesis
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    LY89DRAFT_722376
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    LY89DRAFT_722376
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:psco01007]
    LY89DRAFT_722376
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:psco03016]
    LY89DRAFT_722376
Enzymes [BR:psco01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     LY89DRAFT_722376
Amino acid related enzymes [BR:psco01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   LY89DRAFT_722376
Transfer RNA biogenesis [BR:psco03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    LY89DRAFT_722376
 Prokaryotic type
   Other AARSs
    LY89DRAFT_722376
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1
Motif
Other DBs
NCBI-GeneID: 28828450
NCBI-ProteinID: XP_018066340
JGI: 722376
UniProt: A0A194WVJ2
Position
Unknown
AA seq 662 aa AA seqDB search
MATPKIILPEKGKQNVLITSALPYVNNVPHLGNIIGSVLSADVFSRYSKLRQRPTLFICG
TDEYGTATETKALEDKTTPQELCDKYHKLHKEIYDWFEIGFDYFGRTTTEEQTKIAQDIF
LKLHKNGYLEERTTTQPYCEEESHQSFLADRFVEGTCPKCQYDDARGDQCDKCGSLLDPL
ELINPHCKLHKDAKPVPRETTHIFLRLDKAQPAIEEWFSKSSEEGGWPQNGISITRSWLK
QGLEGRSITRDLKWGTPIPLPGYEKKVLYVWFDACIGYPSITANYTKDWEQWWRNPEDVK
LYQFMGKDNVPFHTIIFPGSQMGTGDKWTMLNHLSTTEYLNYEDGKFSKSRGVGVFGDGA
KETGIPPSVWRYYLLSNRPETGDTQFEWGNFIVANNSELLANLGNFVNRVVKFANAKLNS
TVPEFSASYEDDTFDFPAWIKQVNTHLAEYLAGMDAVKIRDSLRKIMEISSCGNDLLQYR
MDNANLENNPARTHATVGFALNLAYLLASICSPYMPSTADLIVKQLNIPLGPIPDEWSPD
TLKSGHKIGKAAYLFTKIPPEKEQEWKERFGGTQAARLEEEAAKAKKAADKARDKERKRL
KKEAAKAAAAEVEKTDKETDAAPKSEGATTAELEEKIKDTETEIPLRGKVAEEQAPPPAA
AP
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggcgacaccgaaaataattctccccgaaaagggcaaacaaaacgtcttgattacatct
gcgttgccttacgtgaacaacgtacctcatctcggaaatatcattggcagcgtgctcagc
gccgatgtcttctcgagatacagcaaattacgccagagaccgactctcttcatctgcgga
acagatgagtatggcacagctaccgaaacgaaagccctcgaagataagacgaccccacaa
gagttgtgtgacaaatatcacaagctccacaaagaaatctacgactggttcgagattggc
ttcgattattttggccgcacgacaacggaagaacagaccaagattgcccaggatatcttc
ttgaagcttcataagaatgggtacttggaggaaagaacaactacccagccatactgcgaa
gaagagtcacatcaatcgttcctagcggatcgtttcgtggagggcacatgtccgaagtgt
caatacgatgatgctcgaggagatcaatgtgataagtgtggcagtctgctagatcctcta
gagctcatcaatcctcactgcaagctacacaaggatgcaaagcctgttccgcgagaaaca
acccacatctttctgcgtctagataaggcccagccggcgatcgaggagtggttttcgaag
tcaagtgaggaaggtggctggcctcaaaatggaatcagcattacaagatcatggttaaaa
cagggtctggaaggtcgcagtatcaccagagatctgaaatggggaacaccaattcctctg
ccgggctatgagaagaaggttctctatgtttggttcgatgcttgcatcgggtatccctcg
atcacggcgaattataccaaggattgggaacaatggtggcgcaatccagaagacgtcaag
ctgtatcagttcatgggcaaggacaatgtgcctttccacaccattattttcccaggttcg
cagatgggcactggggacaaatggaccatgctcaaccatctatccactacagagtacttg
aactacgaagacggcaaattttccaagtcaagaggagttggcgttttcggagacggtgct
aaagaaactggaattccaccttctgtatggagatactaccttctctctaacagaccagag
accggcgacacccaattcgaatggggcaacttcattgtagccaacaatagtgaactcttg
gccaatctcggaaattttgtcaaccgtgtcgtcaaattcgcgaatgccaaattaaacagt
actgttccagagttctcagcatcctacgaggatgatacatttgatttccccgcctggata
aagcaagtcaacacacatcttgctgagtacttggcaggcatggatgcagtgaagatccga
gacagtctgaggaagatcatggagatttcaagctgtggcaatgatcttctacaataccgt
atggataatgctaaccttgagaacaatccggcacgaacacatgccacagttggattcgca
ttgaaccttgcatatctccttgcttccatctgctcaccatacatgccatcgaccgcagac
ttaatcgtcaagcagttgaacatccctctcgggcccattccagatgaatggtctccagat
actcttaagagtggacacaagattggcaaagctgcttatctgttcacgaaaattcccccg
gagaaagagcaggagtggaaagagcggtttggaggtactcaagctgctagactagaagag
gaggctgctaaggcgaagaaggcagcagacaaagctagagacaaggagcgtaagagattg
aagaaagaagctgctaaagccgccgctgcagaagtagaaaagacagacaaagaaactgat
gctgcaccaaaatccgagggcgccactaccgcagaattagaggaaaaaatcaaggataca
gagacagaaattcccctaagaggaaaagttgcagaggagcaagctccacctcctgcagct
gccccttga

DBGET integrated database retrieval system