KEGG   Phialocephala scopiformis: LY89DRAFT_728458Help
Entry
LY89DRAFT_728458  CDS       T04865                                 

Definition
(RefSeq) pyruvate carboxylase-like protein
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
psco  Phialocephala scopiformis
Pathway
psco00020  Citrate cycle (TCA cycle)
psco00620  Pyruvate metabolism
psco01100  Metabolic pathways
psco01200  Carbon metabolism
psco01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY89DRAFT_728458
   00620 Pyruvate metabolism
    LY89DRAFT_728458
Enzymes [BR:psco01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     LY89DRAFT_728458
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C Biotin_lipoyl_2 ATP-grasp ATP-grasp_3 RimK HlyD_3 HlyD_D23 ATPgrasp_ST NQRA DUF2118 ATP-grasp_4 GARS_A GCV_H RnfC_N
Motif
Other DBs
NCBI-GeneID: 28828992
NCBI-ProteinID: XP_018076656
JGI: 728458
UniProt: A0A194XQ65
Position
Unknown
AA seq 1192 aa AA seqDB search
MADEHNPNGAYSEVFEEGKDAGQAQTIHRIRANSSIMQLKKILVANRGEIPIRIFRTAHE
LSLQTVAVFSYEDRLSMHRQKADEAYVIGKRGQYTPVGAYLAGDEIIKIALQHGVQMIHP
GYGFLSENAGFAKNVEKAGLIFVGPSPEVIDALGDKVSARAIAIKAGVPVVPGTEGAVEK
FEDVKKFTDEYGFPIIIKAAYGGGGRGMRVVREQETLKDSFERATSEAKSAFGNGTVFVE
RFLDKPKHIEVQLLGDNHGNVVHLYERDCSVQRRHQKVVELAPAKDLPPETRDSLLSDAV
KLAKSVNYRNAGTAEFLVDQQNRYYFIEINPRIQVEHTITEEITGIDLIAAQIQIAAGAT
LAQLGLTQDRISTRGFAIQCRITTEDPSKGFSPDTGKIEVYRSAGGNGVRLDGGNGFAGA
IITPHYDSMLVKCTCHGSTYEIARRKMLRALVEFRIRGVKTNIPFLASLLTHPTFIEGNC
WTTFIDDTPELFDLVGSQNRAQKLLAYLGDVAVNGSSIKGQIGEPKFKGDIIMPELFDND
GKKIDTTEPCKKGWRNIIVEEGPEAFAKAVRANKGCLLMDTTWRDAHQSLLATRVRTVDL
LNIAKETSHAYSNLYSLECWGGATFDVAMRFLYEDPWDRLRKMRKLVPNIPFQMLLRGAN
GVAYSSLPDNAIYHFCEQAKKHGVDIFRVFDALNDIDQLEVGIKAVHKAGGVVEGTVCYS
GDMLNPKKKYNLPYYLELVDKLVAMKIHILGVKDMAGVLKPKAATLLIGAIRKKYPDLPI
HVHTHDSAGTGVASMVACAQAGADAVDTATDSLSGMTSQPSVGAVLASLEGSDLDPGLNV
HHVRAIDTYWAQLRLLYSPFEAGLNGPDPDVYEHEIPGGQLTNMMFQASQLGLGAQWAET
KKAYEQANDLLGDVVKVTPTSKVVGDLAQFMVSNKLSFDDVQKRASELDFPGSVLDFFEG
LMGQPYGGFPEPLRTNALRGRRKLDKRPGLVLEPLDLAQIKRDIYKKYGSVTECDVASYA
MYPKVFEDYRKFIQKYGDLSVLPTRYFLSRPEIGEEFHVELEKGKVLILKLLAVGPLSDT
TGQREVFYEMNGEVRQVTVDDIKAAVENTSRPKADPGDSSQVGAPMAGVVVELRVKEGGE
VKKGDPLAVLSAMKMEMVISAPHAGKVGNVQIKEGDSVAGSDLICKIVKPGE
NT seq 3579 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgagcacaatcccaatggcgcctacagcgaggtcttcgaggagggaaaagat
gcaggtcaggcacagaccatccatcgcatccgtgccaattccagtattatgcagttgaag
aagattctcgtggccaatcgaggagaaattcctatccgtatcttccgtacagctcacgag
ctctctttgcagacggtcgcggttttcagttatgaggacagacttagcatgcataggcag
aaagccgacgaagcctacgttattggaaagcgcggtcaatatacacctgttggagcctac
ttggccggtgatgagattatcaagattgctctgcaacatggcgtacaaatgatccatcct
ggttatggtttcctgtcagaaaacgcaggatttgctaagaacgttgagaaggctggtctc
atcttcgtcggtccatctcccgaagtcatcgacgccctaggtgataaagtctctgcgaga
gctattgctatcaaggctggtgtcccagtcgtcccaggtaccgaaggtgccgtagagaaa
ttcgaagatgtcaagaaattcaccgacgaatatggattcccaatcatcatcaaggcagca
tatggaggtggtggacgtggtatgcgtgtcgtccgcgagcaagaaaccttgaaagattcc
ttcgagcgagctacctccgaagccaagtctgcctttggtaacggcacagtcttcgtcgaa
cgtttcttggacaagccaaagcatattgaagtccagcttctgggtgacaatcacggaaac
gtcgttcacttgtacgagcgtgactgctccgtccaacgaagacatcaaaaggtcgtcgaa
ttggctcccgccaaggatcttccccctgagaccagagattctctgctctctgatgcagtg
aagcttgccaagtctgtcaactaccgcaatgctggaacagcggaattcttggttgatcaa
cagaaccgatactactttatcgagatcaaccctcgtattcaggtcgagcacacaattacc
gaggagatcactggcattgatcttattgctgctcagatccaaattgcagctggtgctact
ttggctcagcttggactgacccaggaccgcatttctacgagaggatttgctattcagtgc
cgtatcaccacggaagatccatccaagggattctccccagatactggaaagattgaggtt
taccgatccgctggtggtaacggtgtccgccttgatggtggtaatggattcgctggtgcg
atcatcaccccccactacgattccatgctcgtcaagtgtacctgccatggctccacatac
gagattgctcggaggaagatgcttcgtgctctcgtcgaattccgtattcgtggtgtcaag
accaacattcctttcttagcctcattactcacacaccctacctttattgagggaaattgc
tggacgaccttcatcgatgatacccctgagctgttcgatcttgtcggcagtcaaaaccgt
gctcaaaaattgttggcctacttgggagacgttgctgtgaatggcagcagcatcaaggga
cagattggagaacccaagttcaagggtgacatcatcatgccagaattgttcgacaatgat
ggaaagaagatcgacacaacggagccttgcaagaaaggctggagaaacatcattgtcgag
gagggaccagaggcatttgccaaggccgtccgagcgaataagggatgccttctcatggac
actacatggcgtgatgctcatcaatcgttgttggccacccgtgttcgaacagttgatctg
ttgaacattgcaaaggagaccagccacgcatacagcaatctctacagtcttgaatgctgg
ggaggagcaactttcgatgttgccatgcgtttcctctatgaggatccttgggacagactc
cgaaagatgcgcaaattggttccaaacattcccttccaaatgttgctccgtggtgccaac
ggtgttgcgtactcttctctcccagataacgctatttaccacttctgtgagcaggccaag
aagcacggtgttgatattttcagagtgttcgatgccttgaacgacattgaccaactcgag
gttggtatcaaggctgttcacaaggctggaggtgtagttgagggtacagtgtgctatagt
ggagatatgcttaaccccaagaagaagtacaacctaccatactacttggagctcgtcgac
aagcttgtggccatgaagatccacatcttgggcgtcaaagatatggcgggtgttctcaag
cctaaagcagcgactctcttgatcggagcaatccggaagaagtacccagatttgccgatt
cacgttcacacgcacgactcggctggcaccggtgttgcgtccatggtggcttgcgcccaa
gcaggtgccgacgctgtggatactgctactgacagtttgtctggcatgacttctcaacca
agtgtgggtgctgtccttgcttcattggaaggcagtgatctcgaccctggtctcaatgtt
caccacgtccgagccattgatacctactgggctcaactccgtctcctgtactcgccattt
gaggcaggtctaaatggacccgaccccgatgtctacgagcacgagattccaggtggtcaa
ttgaccaacatgatgttccaagcctctcaacttggtcttggtgctcaatgggcagagacc
aagaaggcttacgagcaagccaatgatctgcttggtgatgtcgtcaaggttactcctact
tccaaggtcgttggtgatttggctcaattcatggtttccaacaagctcagctttgacgat
gttcaaaagcgtgcttccgagcttgatttcccaggctcagtccttgacttctttgagggc
cttatgggtcagccatacggtggatttcctgagccattgagaaccaatgctctccgtggt
cgccgcaagctcgacaagcgccctggtcttgtcttggaaccacttgatctggctcagatc
aagagggatatctacaagaagtatggtagtgtcaccgagtgtgatgttgccagctatgct
atgtatcccaaggtctttgaggattaccgaaaatttatccagaagtatggtgatctgagt
gtgctcccaaccagatacttcttgtctcgacctgaaattggagaggagttccacgttgag
cttgagaagggtaaggttctgatcttgaagcttcttgctgttggtcctctttcggatacc
actggccagagagaggtcttctacgagatgaacggtgaagttcgacaagtcacagttgat
gatatcaaggctgctgttgagaataccagcagacctaaggccgatcctggagacagcagc
caagtcggtgcaccaatggccggtgttgttgttgagcttcgagtcaaggagggtggtgag
gttaagaagggtgacccacttgctgttctcagcgccatgaagatggaaatggtcatctca
gcaccccatgctggtaaagtgggtaatgtccagatcaaggaaggtgactctgttgctggt
tccgatctcatctgtaagattgtcaagccaggagagtaa

DBGET integrated database retrieval system