KEGG   Phialocephala scopiformis: LY89DRAFT_730288Help
Entry
LY89DRAFT_730288  CDS       T04865                                 

Definition
(RefSeq) succinyl-CoA ligase alpha-chain
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
psco  Phialocephala scopiformis
Pathway
psco00020  Citrate cycle (TCA cycle)
psco00640  Propanoate metabolism
psco01100  Metabolic pathways
psco01110  Biosynthesis of secondary metabolites
psco01130  Biosynthesis of antibiotics
psco01200  Carbon metabolism
Module
psco_M00009  Citrate cycle (TCA cycle, Krebs cycle)
psco_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LY89DRAFT_730288
   00640 Propanoate metabolism
    LY89DRAFT_730288
Enzymes [BR:psco01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     LY89DRAFT_730288
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LY89DRAFT_730288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig ATP-grasp_2
Motif
Other DBs
NCBI-GeneID: 28829184
NCBI-ProteinID: XP_018074585
JGI: 730288
UniProt: A0A194XJ05
Position
Unknown
AA seq 676 aa AA seqDB search
MASWQGGTRVLRGSTWSRKHVRFSTSSRRLSYADTVANLKIGTHTRVIFQGFTGRQATAN
AKESIAWGTNIVGGVTPGKNGEHLGLPVLSTVREAMEKLRPDATGIYVAAHQAPAAIEEA
IEAEVPLVIAVAEHIPIHDIMRIHSMLKTQSKSRFVGANAPGIISAIGKCRIGFQPLPCF
MPGRIGIIAKSGTLSYEAVASTTRSGLGQSLCIGMGGDVLAGTNFVDALKIFEHDDDTEG
IILIGEIGGEAELDAAEWIREYRKRTPNPKPISALIAGVHAAPGRVMGHAGAFTLPGESD
APRKIKHLQDAGVIMVNHPSKLGDSMKSLLGSSGRASSGPGVSQRRGIHTLRRVQLQNTI
RWSHAEQRRNLYIHEDQALDLLRERGINASVYSGRGRKRMLGVAVDRANLSPCVIASPAT
DPDQPHIEVKKFPFDYRKGLDPIRVAAIAQHLQLGESSKDSLPKLIDALIDLYMKKEAFQ
LETMFVERLGELKVVGANFGFDDAAFRSTKRQQDVHALRRIKDEDPQEVEAEKDGIVYIK
LAGDGNIGTLVNGAGLAMNTVDALADAGGKAANFLDTGGKATSETVKKSFQVILQDPRVK
VIFVNIFGGLTLGDMIANGILLAFKELEMRLPVVVRIRGTNEEEGQKIIANSGLPLHAFD
DFEEAAAKTIELANQG
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atggcttcatggcagggaggcactcgcgttctgcggggtagcacgtggtctcgaaaacat
gtccgtttcagcacttcttcacgtcgactctcgtatgccgatactgtagcgaatctgaag
atcgggacgcatacgcgggtgatatttcaaggtttcacaggacgtcaagcaactgcaaat
gcaaaggaatcaatagcatggggtaccaatattgtaggaggggtcactcctggaaagaat
ggcgagcatctaggacttcctgtgctgtccactgtccgtgaggcgatggagaagctgaga
ccagacgcaacggggatttacgtagcagcccaccaggctcccgcggccatagaagaagcc
attgaggctgaggttccgcttgtcatcgcagttgctgaacacataccaatccacgatatc
atgcgaatacattcaatgttaaagacccaatcgaagtcaagattcgttggtgcaaatgct
cccggcattatatcagcaattggaaaatgtcggattggatttcaacccctaccttgtttc
atgcctggtcgaattggcatcattgcaaagtctggcacattgagctatgaagctgttgca
tcaaccactcgttctgggcttggacagagtctctgcattgggatgggaggtgatgtcctt
gctggaaccaatttcgtagatgctctgaaaatcttcgaacacgatgatgacacagagggt
atcatcctcattggggagattggtggtgaggcagagcttgatgctgcggaatggattcga
gagtacagaaagcgaacaccaaatcccaagcctatctcggctctgattgctggtgttcat
gctgcgcctggaagggtcatgggtcacgcaggtgcttttaccttaccaggggagtccgat
gccccaagaaagatcaagcacctgcaggatgctggggtaatcatggtcaaccacccatct
aagctgggagactccatgaaatccttgcttggaagctcgggacgggctagtagtggacca
ggggtctctcaacgaagaggcattcacacattgcgaagagtacaactccagaatacaatc
cgatggtcccatgccgagcaacgtcgaaacctatatattcatgaggatcaagccctggac
ctccttcgagagcggggtatcaacgcatccgtctattctgggagaggtcgaaaacgtatg
ttaggcgtcgctgtcgaccgagcaaatctttcgccctgcgttattgcttcaccagcaact
gaccccgaccaaccgcacatcgaggtcaaaaaatttccgtttgattatagaaaaggtctt
gatccgattcgagttgctgcaatcgctcagcatctgcaacttggtgaatcgtcgaaggac
tccctgccgaagctcatcgatgctttgattgacctctacatgaagaaggaggcattccaa
ctagagacaatgttcgtggaacgtttaggcgagctcaaagtagtcggggcgaattttggt
tttgacgatgcagcttttcgaagtactaaacgacagcaagacgttcatgctctgcgcaga
atcaaggatgaagatcctcaagaagtagaggctgagaaagatggcattgtatacatcaag
cttgctggggatgggaatataggaaccctggtcaatggagctgggcttgcgatgaacact
gtcgatgcattggcagatgctggtggtaaggctgcgaactttctagatacagggggcaaa
gctacaagtgagacggtcaagaagagtttccaggtgatcttgcaagatccgagggtgaaa
gtcatatttgtgaacatctttggaggcttgaccctaggtgacatgattgccaatgggatc
ctgctagctttcaaagagcttgagatgagacttccagtcgttgttaggattcgtggaacg
aacgaagaggaaggtcaaaagatcattgctaatagtggattaccattgcatgctttcgat
gacttcgaagaagcggccgccaagactatcgaattagcgaatcagggatag

DBGET integrated database retrieval system