KEGG   Phialocephala scopiformis: LY89DRAFT_786695Help
Entry
LY89DRAFT_786695  CDS       T04865                                 

Definition
(RefSeq) Nucleotidylyl transferase
  KO
K06210  nicotinamide mononucleotide adenylyltransferase [EC:2.7.7.1 2.7.7.18]
Organism
psco  Phialocephala scopiformis
Pathway
psco00760  Nicotinate and nicotinamide metabolism
psco01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:psco00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    LY89DRAFT_786695
Enzymes [BR:psco01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.1  nicotinamide-nucleotide adenylyltransferase
     LY89DRAFT_786695
    2.7.7.18  nicotinate-nucleotide adenylyltransferase
     LY89DRAFT_786695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CTP_transf_like
Motif
Other DBs
NCBI-GeneID: 28832737
NCBI-ProteinID: XP_018065394
JGI: 786695
UniProt: A0A194WTN1
Position
Unknown
AA seq 270 aa AA seqDB search
MASDISAQAAAPPSSENAFPSHRLTLRQRYPEKTPLVLVACGSFSPITYLHLRMFEMASD
YARFNTEFEIMGGYLSPVGDAYKKAGLAAATHRLRMCELAVESSEFIMVDHWEAKNSSYI
PTALVLDHFNHEINEVLGGAEKPDGTRVPIRIVLLAGADLVQTMSTPGVWSIDDLDHILK
VYGAFIVERQGTDIDDALSSLEAYRNNIYVIKQIIQNDVSSTKIRLFLRRELSIRYLVPS
AVVEYIEANDLYKAEGVPQIEDKGKGKAVG
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atggcttccgacatttcagctcaagccgctgctccgccgtcctccgagaatgctttccct
tcgcatcgccttactttgcgacaacgctatcctgagaaaacgcctcttgtgctggtggct
tgcggatctttctctccaataacttatcttcatttgaggatgttcgaaatggcgtcagac
tatgctagattcaataccgaattcgaaattatgggtggatatctctcacctgtcggagat
gcatacaagaaggctggccttgccgcggcgacacacagactccggatgtgtgaattggct
gtagaatcatcggagtttataatggttgatcactgggaagccaagaatagttcatacata
cctacggctctggtgctagatcacttcaaccatgagattaatgaggtcctcgggggagca
gaaaagccagatgggaccagagtacctatacggattgtactcttagctggagcagacctt
gtccaaactatgtctacaccaggtgtatggagcattgacgatttggatcacattcttaaa
gtctacggcgctttcatcgtggaacgacaagggaccgatatcgacgatgcgctctcaagt
cttgaggcttatagaaataatatctacgtgatcaaacaaatcatacaaaacgacgtcagc
tcgaccaagatcagactcttcctacgaagggaactgagcatcaggtacctggtcccctca
gcagtcgtcgaatatatcgaggcaaacgatctatacaaggcggaaggcgtaccacaaata
gaagacaaagggaaagggaaagcagtcggttaa

DBGET integrated database retrieval system