KEGG   Pseudoxanthomonas spadix: DSC_00285Help
Entry
DSC_00285         CDS       T01643                                 

Definition
(GenBank) N-acetylglucosamine-6-phosphate deacetylase
  KO
K01443  N-acetylglucosamine-6-phosphate deacetylase [EC:3.5.1.25]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00520  Amino sugar and nucleotide sugar metabolism
psd01100  Metabolic pathways
psd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    DSC_00285
Enzymes [BR:psd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.25  N-acetylglucosamine-6-phosphate deacetylase
     DSC_00285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidohydro_1 Amidohydro_3
Motif
Other DBs
NCBI-ProteinID: AER54710
UniProt: G7US41
Position
complement(3293092..3294240)
Genome map
AA seq 382 aa AA seqDB search
MSRFALVNARVLAEAGIVDGGALVIEDGRIIALTDAAGARARTDDLRDLGGAWLAPGFID
LQVNGGGGVLFNNTPTAAGIAAIGRAHRRFGTTAFLPTLISDGADTMRRAIAATGQAIAN
GVDGVLGIHLEGPYLAPARKGTHDARQFRAPDEDEMAMATALDNGITLMTVAPERLGPER
IAALVARGALVFAGHTAGSYEQIRAGLDAGLRGFTHLFNAMSPLQGRSPGAVGAALEDEA
SWCGVIVDGVHVHPGALRVALAAKRPGKLLLVTDAMPMVGADSPSFELYGETITAVDGVV
RNAAGALAGSALDMASAVRNSVRLLGLPLQEAVRMAALYPAQCLGLAHERGRIAPGLRAD
LVALDDRLQVIETWIGGRSATG
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagccgctttgccctggtcaacgcgcgggtgctggccgaggcgggcatcgtcgatggc
ggcgcgctggtgatcgaggacggccgcatcattgccctgaccgacgccgctggcgcgcgc
gcccggaccgacgacctgcgcgacctgggcggggcgtggctggcgccgggtttcatcgac
ctgcaggtcaacggaggcggcggggtgctgttcaacaacacgcccaccgccgcgggcatc
gccgccatcgggcgcgcgcatcgcaggttcggcaccaccgcattcctgcccacgctgatc
agcgatggcgccgacaccatgcgccgggcgatcgccgccaccggccaggccatcgccaat
ggcgtggacggggtgctgggcatccacctggaaggcccgtacctggcgccggcacgcaag
ggcacccacgacgcgcggcagttccgcgcaccggacgaggatgaaatggccatggccacc
gcgctggacaatggcatcaccttgatgaccgtcgcaccggaacggctggggcccgaacgc
atcgccgcgctggtcgcgcgcggggcgctggtgttcgccggccacaccgccggcagctac
gagcagatccgcgccggactggacgcgggcctgcgcgggttcacccatctgttcaacgcc
atgtcgccgctgcaagggcgcagccccggcgcggtcggcgcggcgctggaagatgaagca
agctggtgcggggtgatcgtcgatggcgtgcacgtgcatccgggcgcgctgcgcgtggcg
ctggcggccaagcggccgggcaagctgctgctggtgaccgatgcgatgccgatggtcggt
gccgacagccccagtttcgagctttacggcgaaaccatcaccgcggtcgacggggtggtg
cgcaacgccgccggtgcgctggccggctcggcgctggacatggccagcgcagtgcgcaac
agcgtgcggctgctcggcctgccgctgcaagaagccgtgcgcatggccgcgctgtatccg
gcccagtgcctgggcctggcccacgagcgcggccgcatcgcccccggcctgcgtgcggac
ctggtggcactggacgatcgtctgcaggtcatcgaaacctggatcggcggacgcagcgcg
accggctag

DBGET integrated database retrieval system