KEGG   Pseudoxanthomonas spadix: DSC_00760Help
Entry
DSC_00760         CDS       T01643                                 

Definition
(GenBank) winged helix family two component transcriptional regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd02020  Two-component system
Brite
KEGG Orthology (KO) [BR:psd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DSC_00760
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:psd02022]
    DSC_00760
Two-component system [BR:psd02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   DSC_00760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C Phage_TAC_6
Motif
Other DBs
NCBI-ProteinID: AER54805
UniProt: G7USU4
Position
3401061..3401780
Genome map
AA seq 239 aa AA seqDB search
MNQTTASLLLVDDDLRLRELLLRYLEGQGFTVKGVGDGAQMRQALDRGHFDLIVLDLMLP
GESGLELCRRLRGQGDSTPVVMLTAKGDEIDRIVGLEIGADDYLPKPVNPRELLARIRSV
LRRTQAMPGAPQAEGGTVNFGPWTLDLGTRQLTRAGVPVKLTSGEFAVLAVLVRHPRQPL
SRDRLMSLARGRGHEAFERSMDVTIARLRKLLEDDPRNPAIVQTVWGVGYVFVPPEGRA
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagaccaccgccagccttctgctggtcgacgacgacctgcgcctgcgcgagctg
ctgctgcgctacctggaaggccagggcttcacggtcaagggcgtgggcgacggtgcacag
atgcgccaggcgctggatcggggccacttcgacctgatcgtgctggacctgatgctgccc
ggcgagagcgggctggaactgtgccggcgcctgcgcggccagggcgacagcacgccggtg
gtgatgctcaccgccaagggtgacgagatcgaccgcatcgtcggcctggaaatcggcgcc
gacgactacctgcccaagccggtcaatccgcgcgagctgctggcccggatccgctcggtc
ctgcgccgcacccaggccatgccaggcgcgccgcaggccgagggcggcacggtcaacttc
ggtccctggacgctggacctgggtacccgccagctgacccgcgcaggcgtgccggtgaag
ctgacctcgggcgaattcgcggtgctggcggtgctggtgcgccatccgcgccagccgctc
tcgcgcgaccggttgatgagcctggcgcgcgggcgcgggcacgaggcgttcgagcgcagc
atggatgtgaccatcgcgcgcctgcgcaagctgctggaggacgatccgcgcaacccggcg
atcgtgcagaccgtgtggggggtgggctatgtgttcgtgccgccggagggccgcgcatga

DBGET integrated database retrieval system