KEGG   Pseudoxanthomonas spadix: DSC_01655Help
Entry
DSC_01655         CDS       T01643                                 

Gene name
phhA
Definition
(GenBank) phenylalanine 4-monooxygenase
  KO
K00500  phenylalanine-4-hydroxylase [EC:1.14.16.1]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00360  Phenylalanine metabolism
psd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
psd00790  Folate biosynthesis
psd01100  Metabolic pathways
psd01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    DSC_01655 (phhA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DSC_01655 (phhA)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DSC_01655 (phhA)
Enzymes [BR:psd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.16  With reduced pteridine as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.16.1  phenylalanine 4-monooxygenase
     DSC_01655 (phhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Biopterin_H
Motif
Other DBs
NCBI-ProteinID: AER54984
UniProt: G7UU95
Position
complement(149470..150360)
Genome map
AA seq 296 aa AA seqDB search
MNTPPRRAANPLTDKGYVPVYSTAVVDQRWDRYTPQEHATWGRLFERQRSVLQGRACEEF
LVAQDAMGMIAQQIPRFDDLNVVLGAATGWQLVSVEGLLPELTFFEHLANRRFPVTWWIR
RPEQLDYLAEPDLFHDLFGHVPLLMDRRFADYMQAYGRGGVKAHRIGPDALVNLTRLYWY
TVEFGLINTPQGLRIYGSGIVSSRGESLHALESDAPNRIGFDLMRVMRTRYRIDDFQKTY
FVIDSFDALIQATAADFTALYTQLQQAQALPAGRVQDHDRILHRGTGAGWADAGDV
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcccccgcgccgcgccgcgaacccgctcaccgacaagggctacgtgccggtc
tacagcaccgccgtggtggaccagcggtgggatcgctacacgccgcaggagcacgccacc
tggggccgcctgttcgagcgccagcgcagcgtgctgcaaggccgggcctgcgaggagttc
ctggtggcgcaggacgcgatgggcatgatcgcccagcagatcccgcgctttgacgacctc
aacgtggtgctgggtgcggccaccggctggcagctggtgagtgtggaaggcctgctgccg
gaactgaccttcttcgaacacctggccaacaggcgcttcccggtgacctggtggatccgc
cggcccgagcagctcgactaccttgccgagccggacctgttccatgacctgttcggccac
gtgccgctgctgatggaccggcgctttgccgactacatgcaggcctacggccgcggcggg
gtcaaggcgcaccgcatcggccccgacgcgctggtcaacctgacccggctgtactggtac
acggtggagttcggcctgatcaatacgccgcaggggctgcgcatctacggcagcggcatc
gtctcctcgcgcggcgaatcgcttcatgcgctcgaatcggacgcgcccaaccggatcggc
ttcgacctcatgcgggtcatgcgcacgcgctaccgcatcgacgatttccagaagacctac
ttcgtgatcgacagcttcgatgcgttgatccaggccaccgcagcggacttcaccgcgctc
tacacgcagctgcaacaggcccaggcgctgccggccgggcgcgtgcaggaccacgatcgc
atcctgcaccgcggcaccggcgcgggctgggccgacgctggcgacgtgtag

DBGET integrated database retrieval system