KEGG   Pseudoxanthomonas spadix: DSC_05720Help
Entry
DSC_05720         CDS       T01643                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase/mannose-6-phosphate isomerase
  KO
K16011  mannose-1-phosphate guanylyltransferase / mannose-6-phosphate isomerase [EC:2.7.7.13 5.3.1.8]
Organism
psd  Pseudoxanthomonas spadix
Pathway
psd00051  Fructose and mannose metabolism
psd00520  Amino sugar and nucleotide sugar metabolism
psd01100  Metabolic pathways
psd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:psd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    DSC_05720
   00520 Amino sugar and nucleotide sugar metabolism
    DSC_05720
Enzymes [BR:psd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     DSC_05720
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.8  mannose-6-phosphate isomerase
     DSC_05720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MannoseP_isomer NTP_transferase Cupin_2 NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AER55795
UniProt: G7UQR3
Position
1027731..1029134
Genome map
AA seq 467 aa AA seqDB search
MTQLQPVLLSGGSGTRLWPLSREAYPKQFLPLGGRDTMVQATWRRVEPLTSLPPLVVANE
DHRFLVAEQLRQIKAPQPRILLEPVARNTAPAIAAAALCALEDGADPLLLVLPSDHVISN
PQAFRDAVEQAIPAAEAGALVTFGVVPSSPETGFGYIQAGGGQGAQPVLRFVEKPDAQTA
ARYLAEGSYFWNSGMFLFKASRYVEELQKFNPQMVAAVRTSLEKAKRDGDFIRLDKEAFT
ASPSDSIDYAVMEKTADAKVLPLDVGWNDVGSWSALWEVTDKDANGNACAGDVITIDTHN
SYVYAESLVALVGLDDVVVVETDDAILVARKDRVQEVKKVVAQLKHDERSQAVLHRKVYR
PWGAYDSIDMGARFQVKRITVNPGATLSLQMHHHRAEHWIVVSGTAEVTRGEEVILLTEN
QSTYIPLGVTHRLKNPGRLPLELIEVQSGSYLGEDDIVRFQDQYGRS
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcttcagcccgttctgctgtcgggcggttccggaacgcgcctgtggccgctc
tcgcgcgaggcctatcccaagcagttcctgccgctcggtggccgggacacgatggtccag
gccacctggcgccgggtcgaaccgttgacctcgctgccgccgctggtggtggccaatgag
gaccaccgcttcctggtggccgaacagctgcgccagatcaaggcaccgcagccgcggatc
ctgctggagccggtcgcccgcaacaccgcgccggccattgccgccgccgcgctgtgtgcg
ctggaagacggcgccgacccgctgctgctggtgctgccgtccgaccacgtgatcagcaac
ccgcaggcgttccgcgatgcggtcgagcaggccattccggcggccgaggccggcgcgctg
gtgaccttcggggtggtgcccagcagcccggagaccggctttggctacatccaggccggt
ggcggccagggcgcgcagccggtgctgcgtttcgtcgaaaaacccgacgcccagactgcc
gccaggtatcttgccgaaggcagctacttctggaacagcggcatgttcctgttcaaggcc
agccgctacgtcgaggaattgcagaagttcaatccgcagatggtcgccgcggtccgcacc
tcgctggaaaaggccaagcgcgatggcgacttcatccgcctggacaaggaggccttcact
gcctcgccgtccgattcgatcgattacgcggtgatggaaaagaccgccgatgccaaggtg
ctgccgctggacgtgggctggaatgatgtcggttcgtggtcggcattgtgggaagtcacc
gacaaggacgccaacggcaatgcctgcgccggcgatgtcatcaccatcgatacgcacaac
agctacgtctatgccgagagcctggtcgcgctggtgggcctggatgatgtggtggtggtg
gaaaccgacgacgcgatcctggtggccaggaaggaccgcgtgcaggaggtcaagaaggtc
gtggcccagctcaagcacgatgagcgcagccaggcggtcctgcaccgcaaggtctatcgg
ccgtggggcgcctacgactcgatcgacatgggcgcgcgtttccaggtcaagcgcatcacg
gtcaatcccggtgccacgctgagcctgcagatgcaccaccaccgcgccgagcactggatc
gtggtcagcggcaccgccgaggtgacccggggcgaggaggtcatcctgctgaccgaaaac
cagagcacctacattccgctgggcgtgacccaccgcttgaagaacccgggccgcctgccg
ctggagctgatcgaagtgcagtccggcagctatctgggcgaggacgacatcgtgcgcttc
caggaccagtacgggcgcagctga

DBGET integrated database retrieval system